KEGG   Spirochaeta smaragdinae: Spirs_1425Help
Entry
Spirs_1425        CDS       T01287                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Spirs_1425
Enzymes [BR:ssm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Spirs_1425
    3.5.1.-  
     Spirs_1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1523422..1524057
Genome map
AA seq 211 aa AA seqDB search
MSASALILIDIQNDFCPEGALAVTDGDAIVPPINRLLDSPGRSGFGKVVATADWHPLGHI
SFASTHEGKKVNDRIEANGITQNLWPVHCVAGTPGADFHPVLDIDRADLILRKGTSLHLD
SYSAFFENDGKTPTGLHGYLQTCGIDTVFLAGLALDWCVFFSALDALALGYKTTILQDLC
RPVDQPAGFSDKRVGELRMKGVLVSTSESLI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaagcgcattaatattaattgatattcagaacgatttttgtcccgaaggtgcc
ctggccgttacggacggggatgcaattgtcccacctatcaaccgtctgcttgactccccc
ggccgttcgggattcgggaaggtggtggctaccgccgattggcaccccttaggccatatt
tcctttgcctccacccatgaggggaaaaaggtcaatgatcggatagaggccaacggtatc
acccaaaatttatggccggttcactgtgtggcaggaacgcctggagccgattttcatccc
gtcctggatatcgacagggccgatctgatactaagaaaaggaacctccctccatctcgat
tcgtactcggcctttttcgaaaacgacggaaagacccctaccggacttcatggctatctg
caaacctgcggaatcgatacggtttttcttgcgggccttgccctggactggtgtgtcttt
ttttcagcccttgatgcccttgcccttgggtataaaacgacgatactgcaggatctttgc
aggcctgtcgatcagcctgcgggtttttccgataagcgggtaggggaactcaggatgaag
ggtgtcctcgtcagtacatcggagagcttgatatga

DBGET integrated database retrieval system