KEGG   Spirochaeta smaragdinae: Spirs_1433Help
Entry
Spirs_1433        CDS       T01287                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Spirs_1433
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spirs_1433
Enzymes [BR:ssm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Spirs_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1530354..1531943
Genome map
AA seq 529 aa AA seqDB search
MNTNTFQGRTLAVIRDFSQEERLYLFSHTRRLKQALLEGDRKTVDEYRIDDGDFGIYEVF
LEDSTRTKESFKNAAQFHGVKLNSLDVGHSSINKKESYADTFNTLCGYDNKIFIVRSTLE
GVCRWLEENGKEFARRNGLSVPPAFINAGDGKHEHPTQELLDEFSFLEQLDWDESRLHIA
LVGDLYHGRTVHSKVDGLKLFGSVSVDLIAPKELAMPEYYVRKMEENDFAVRTFSSIEEY
LSQSNTAPIWYFTRPQLERMGDDILKRQDELRSKIVFRREFLSKIADGTKFYHPLPRHKE
HPTIPTFLDDTELNGWENQSINGKLIRIVLLSLIAGKIGHDFVPKAEKPLASVDDEPFLQ
DVPVAQDGPPKQYAEGVNPISDGIVIDHICRGDSEQEIREHMARIIGVLKLYGKGGEWVT
SSRIAPGTMKGIIFRPGFSGFDGKQMKQLAAIAPGSTLNIIHESRVVKKLRLHMPPRIYN
FDTISCSNTACISHPSNGESVPAEFFRVAGDIFVCKYCEKPHTFKEIWK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaatacgtttcaggggaggaccctggcagttatcagggacttcagtcaggaa
gaacggctttatcttttttcgcatactcgaagattgaagcaggcacttttggagggcgac
aggaaaaccgtcgatgagtatcgtatcgacgacggcgacttcggtatctacgaggtattt
ctggaggacagtactcggacaaaggagtcgttcaaaaatgcggcccagtttcatggagtc
aaactcaacagcctcgatgtcggacacagctccatcaataaaaaagagagctatgccgat
accttcaataccctttgcggctatgataataagatctttattgtccgcagtaccttggaa
ggggtttgccgatggcttgaagaaaacggaaaggagtttgctcgccggaacggactttcc
gtgccccccgccttcatcaatgccggagacggtaagcacgaacatccgactcaagagctg
ctcgatgagttcagcttccttgaacagcttgattgggacgaatccaggctgcatattgcc
cttgtaggagatttgtatcacggcagaacggttcactcgaaggtcgacggtttaaagctc
tttggttcggtctcggttgatctgattgcaccgaaggaacttgccatgcccgaatactat
gtcaggaaaatggaagagaacgattttgctgtccgcactttttcttccatcgaagagtat
ctttcccaatcgaatacggcaccgatctggtattttacccgtccacagttagaacgaatg
ggtgacgatattctgaaacggcaggatgaactccgcagcaaaatcgtttttcgaagggag
ttcctttctaaaatcgctgacggaacgaaattttatcatccccttccccgacacaaggag
cacccgaccattcccaccttccttgacgataccgagctcaacggctgggagaatcagtcg
atcaacgggaaattgatccgtatcgtactgctctctctcatcgccggaaaaatcggacac
gattttgtccctaaggcagaaaagcctcttgcttcggtcgatgatgagcccttccttcag
gatgtccccgttgcccaggatgggccgccgaaacagtatgccgagggggtaaatcctatc
tcagacggtatcgtgatcgatcatatttgccggggggacagcgagcaggagatcagagag
catatggcacgaatcatcggggtgctcaagctctacggaaagggcggcgagtgggtaacc
agcagccgcatcgctcccggtaccatgaaaggaatcattttccgccccggtttctcgggt
tttgacgggaagcaaatgaagcagcttgcggccatcgcgccggggagcaccctcaacatc
atccatgaaagcagggtggtcaaaaaactgcggctgcacatgccgccgcggatctacaat
ttcgacaccatcagttgtagtaatacggcatgtatcagccacccctcaaacggtgagtcg
gtccctgccgagtttttccgggttgcaggagatattttcgtatgcaaatattgcgagaag
ccacacaccttcaaggagatctggaaatga

DBGET integrated database retrieval system