KEGG   Spirochaeta smaragdinae: Spirs_1433Help
Entry
Spirs_1433        CDS       T01287                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ssm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ssm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1530354..1531943
Genome map
AA seq 529 aa AA seqDB search
MNTNTFQGRTLAVIRDFSQEERLYLFSHTRRLKQALLEGDRKTVDEYRIDDGDFGIYEVF
LEDSTRTKESFKNAAQFHGVKLNSLDVGHSSINKKESYADTFNTLCGYDNKIFIVRSTLE
GVCRWLEENGKEFARRNGLSVPPAFINAGDGKHEHPTQELLDEFSFLEQLDWDESRLHIA
LVGDLYHGRTVHSKVDGLKLFGSVSVDLIAPKELAMPEYYVRKMEENDFAVRTFSSIEEY
LSQSNTAPIWYFTRPQLERMGDDILKRQDELRSKIVFRREFLSKIADGTKFYHPLPRHKE
HPTIPTFLDDTELNGWENQSINGKLIRIVLLSLIAGKIGHDFVPKAEKPLASVDDEPFLQ
DVPVAQDGPPKQYAEGVNPISDGIVIDHICRGDSEQEIREHMARIIGVLKLYGKGGEWVT
SSRIAPGTMKGIIFRPGFSGFDGKQMKQLAAIAPGSTLNIIHESRVVKKLRLHMPPRIYN
FDTISCSNTACISHPSNGESVPAEFFRVAGDIFVCKYCEKPHTFKEIWK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaatacgtttcaggggaggaccctggcagttatcagggacttcagtcaggaa
gaacggctttatcttttttcgcatactcgaagattgaagcaggcacttttggagggcgac
aggaaaaccgtcgatgagtatcgtatcgacgacggcgacttcggtatctacgaggtattt
ctggaggacagtactcggacaaaggagtcgttcaaaaatgcggcccagtttcatggagtc
aaactcaacagcctcgatgtcggacacagctccatcaataaaaaagagagctatgccgat
accttcaataccctttgcggctatgataataagatctttattgtccgcagtaccttggaa
ggggtttgccgatggcttgaagaaaacggaaaggagtttgctcgccggaacggactttcc
gtgccccccgccttcatcaatgccggagacggtaagcacgaacatccgactcaagagctg
ctcgatgagttcagcttccttgaacagcttgattgggacgaatccaggctgcatattgcc
cttgtaggagatttgtatcacggcagaacggttcactcgaaggtcgacggtttaaagctc
tttggttcggtctcggttgatctgattgcaccgaaggaacttgccatgcccgaatactat
gtcaggaaaatggaagagaacgattttgctgtccgcactttttcttccatcgaagagtat
ctttcccaatcgaatacggcaccgatctggtattttacccgtccacagttagaacgaatg
ggtgacgatattctgaaacggcaggatgaactccgcagcaaaatcgtttttcgaagggag
ttcctttctaaaatcgctgacggaacgaaattttatcatccccttccccgacacaaggag
cacccgaccattcccaccttccttgacgataccgagctcaacggctgggagaatcagtcg
atcaacgggaaattgatccgtatcgtactgctctctctcatcgccggaaaaatcggacac
gattttgtccctaaggcagaaaagcctcttgcttcggtcgatgatgagcccttccttcag
gatgtccccgttgcccaggatgggccgccgaaacagtatgccgagggggtaaatcctatc
tcagacggtatcgtgatcgatcatatttgccggggggacagcgagcaggagatcagagag
catatggcacgaatcatcggggtgctcaagctctacggaaagggcggcgagtgggtaacc
agcagccgcatcgctcccggtaccatgaaaggaatcattttccgccccggtttctcgggt
tttgacgggaagcaaatgaagcagcttgcggccatcgcgccggggagcaccctcaacatc
atccatgaaagcagggtggtcaaaaaactgcggctgcacatgccgccgcggatctacaat
ttcgacaccatcagttgtagtaatacggcatgtatcagccacccctcaaacggtgagtcg
gtccctgccgagtttttccgggttgcaggagatattttcgtatgcaaatattgcgagaag
ccacacaccttcaaggagatctggaaatga

DBGET integrated database retrieval system