KEGG   Spirochaeta smaragdinae: Spirs_1442Help
Entry
Spirs_1442        CDS       T01287                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Spirs_1442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_1442
  Lipid metabolism
   00071 Fatty acid degradation
    Spirs_1442
  Amino acid metabolism
   00350 Tyrosine metabolism
    Spirs_1442
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Spirs_1442
   00626 Naphthalene degradation
    Spirs_1442
Enzymes [BR:ssm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Spirs_1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1541283..1542464)
Genome map
AA seq 393 aa AA seqDB search
MEQFSTYIPTQIQFGPGSLESLGREKLPGKKALIVVSAGGSMKRHGYLDRTAALLKKQGI
DSVIFDKILPNPILSHVMEGAALARQEGCDFVLGLGGGSSIDSAKSIAVMVNNPGDYWDY
INGGSGKGKPVTEAVLPIVAITTTAGTGTEADPWTVITNQDKNEKIGFGTPDTFPTLSIV
DPELMLSVPPKLTAYQGFDAFFHAAEGYIANIATPISDLYALESVRLVSRYLPRVVADGN
DIEARSKVALANTLSGMVESTSSCTSEHSMEHALSAFKPELPHGAGLIMLSKAYFTHFAS
VVPQRLATLAEAMGEETSAVPEADRAMLMVTALEKLQRACGVDELKMSDYGLEKAQIPAY
AQNARNTMGGLFEMDRAPLNTQDVIAIYEKAYR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaacagttttccacctatattcctacccaaattcagttcggtcctggatcgctcgaa
agtctcggacgtgaaaaactgccgggaaaaaaggcgctcatcgttgtttcggccggcggt
tcaatgaagcgccatggctacctcgacaggacggcggctcttctgaaaaagcagggaatc
gattcggttatctttgataaaattctgcccaacccgattctttcccacgtcatggaggga
gcggctctggcaaggcaagagggttgcgactttgtccttggtctgggaggaggaagcagc
atcgactcggcaaagagtatcgccgtcatggtgaataatcctggagactactgggattac
atcaacggcggcagtggtaagggaaagccggttaccgaagcagtgctgcccattgttgcg
ataacgaccaccgcaggcaccggtaccgaggcagatccctggaccgttatcaccaaccag
gataaaaatgaaaaaatcggtttcggcacccccgacaccttccccaccctctccatcgtc
gatcccgaacttatgctttcggtcccgccaaaactgaccgcctaccagggcttcgatgcc
ttctttcatgcagcagaggggtatatcgccaatattgccacgcctatcagcgacctctac
gcccttgaaagcgtacgactggtcagccgatacctccccagggtcgttgcggatggaaac
gacatcgaggcaagaagtaaggttgccctggccaacaccctttcggggatggtggaatct
acctcaagttgtacctcggagcacagcatggagcatgcgctaagcgcctttaagcccgaa
ctcccccacggggccgggcttatcatgcttagcaaggcctacttcacccactttgcatcg
gtagtcccccagcggcttgcaacgcttgccgaggccatgggagaggagacctccgcagta
ccagaggctgatcgtgccatgttgatggtcacggccctggaaaaactccaaagggcgtgt
ggagtcgatgaactaaagatgtccgactacggccttgagaaggcccagatccctgcgtat
gcacaaaatgcccgtaacaccatgggaggactctttgaaatggacagagccccgctgaac
acgcaggatgtcattgcgatctacgagaaggcttaccgctga

DBGET integrated database retrieval system