KEGG   Sediminispirochaeta smaragdinae: Spirs_1444Help
Entry
Spirs_1444        CDS       T01287                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spirs_1444
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_1444
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spirs_1444
Enzymes [BR:ssm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spirs_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1544841..1546052
Genome map
AA seq 403 aa AA seqDB search
MRDYFKQQPDTKGFFGSYGGSFIPEALQKEMDKITDAYYSISKSHHFISELRSIRKHFQG
RPTPVYYARTLSDELGGRIYLKREDLNHTGAHKLNHCMGEALLAKYMGKKKLIAETGAGQ
HGVALATAAAYFGLECEIHMGEVDIRKEHPNVIRMKLLGANVVPVTSGLKTLKEAVDSAF
SAYLEDPVNSIYCIGSVVGPHPFPMMVRDFQRVVGIEAKEQFFEMTGEMPDNVVACVGGG
SNSMGIFTAFLDEEDTTLYGVEPSGRSLQKGEHAATMCYGKPGLIHGFKCYLLQNDKGEP
DPVYSIASGLDYPGVGPEHSALKDAGKVVYETASDKEALTAFYTLSRKEGIIPALESAHA
VAFAMKLAKQEPRKSILVNLSGRGDKDIDFIVENYGTGPEVKA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactattttaagcaacaacccgatacaaagggtttttttggttcctacggggga
agttttattcctgaagctttacaaaaagagatggacaaaatcaccgatgcctactattcc
atcagcaaaagccatcacttcatttccgagcttcgcagcatccgcaaacacttccagggg
cgtcccactccggtctactacgccaggaccctttccgacgaattggggggacggatttat
ttaaagcgggaagatctcaaccataccggggcacataagctgaaccactgtatgggtgag
gcacttcttgccaaatacatgggaaagaaaaagctgattgccgagaccggtgcgggacaa
catggtgtcgcccttgccaccgccgccgcttatttcggactcgagtgcgaaattcatatg
ggtgaggtcgatatcaggaaagagcatcccaacgtcatccgcatgaaacttctgggggcc
aatgttgttcccgttacctctggattgaagaccctaaaggaggcggttgattcggctttt
tctgcctatctcgaggaccctgtcaattcaatctattgtatcgggtcggtggtcggtccc
catccctttcccatgatggttcgcgattttcagcgggttgtgggaattgaggcaaaggag
cagtttttcgagatgactggcgagatgccggacaatgttgtggcctgcgtgggaggtgga
agtaactccatgggcattttcacggccttcctcgacgaagaggataccaccctctacggt
gttgagccttccggccgttccctgcagaagggcgaacatgccgcaaccatgtgctatgga
aagcccggactcatacacggtttcaagtgctatcttttgcagaatgataagggggagccg
gatcccgtctattcgattgccagcggtctcgattatccaggtgtggggcctgagcattcg
gccttgaaggatgcagggaaggtggtctacgagactgccagcgataaagaggcccttaca
gccttctatacactcagccgcaaggaggggatcattcccgctctggagagtgcccatgcc
gttgccttcgccatgaagcttgcaaagcaggagcctcgcaaatccatcctggtcaacctt
tcgggacgaggggataaggacatcgacttcattgtggaaaactacggaacagggccggag
gtaaaggcataa

DBGET integrated database retrieval system