KEGG   Spirochaeta smaragdinae: Spirs_1812Help
Entry
Spirs_1812        CDS       T01287                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spirs_1812
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Spirs_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1957047..1957979
Genome map
AA seq 310 aa AA seqDB search
MVAVILSIMTLTIEAPAKINLHLQVGKLRSDGYHDLLSLMHLVDLSDRVSLRMEGKGGTV
ELEGNFDCRKEDNLLYKAASAYLQERQKRVPNASPAPGLTISCLKRIPAGGGLGGGSSDA
AALLKLLDRFFGAFPQKGVLDEIALSLGSDVPFFLHTGAEIAQGRGEVLEPVEPLPAYPL
VLVFPKWRISTPDAYASVDRLRREKADRPRSLSLEQLRESYSRPVAQWPFFNDFTSPVLL
QFPESRNLLLGLQNQGALFSQMSGSGSTFFGLFDGEKTALRAFERLKSMGYRCHLGKMLA
RPYDPVYNGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtagcggttatactatcgatcatgacactgacaatagaggctccggccaagataaat
cttcaccttcaagttggaaagcttcgttcggacggctatcatgaccttctcagcttaatg
cacctcgtcgatctttcagatagggtgagcctgcggatggaaggaaaagggggaacggtg
gagcttgaagggaatttcgactgccggaaggaggacaatttgctgtataaggctgcctcg
gcctatcttcaagaaagacaaaagagggtgccgaatgcttccccggctcctggtttgacc
atttcctgtttgaaaagaatcccggcggggggagggctcggtggaggatcatccgatgcc
gctgcgctattaaagctgcttgaccgttttttcggggcttttccccaaaagggggttctc
gatgagattgccctttctttggggagcgatgttccttttttcctccacacaggggctgag
atagcccagggaaggggcgaggtgctcgaacccgtggaacctcttcccgcttatccactt
gtgttggtatttccgaaatggaggatttcgactcccgacgcctatgcctcggtcgatagg
cttaggcgcgaaaaagcggatcgtccccgctccctttccctcgagcagttacgcgaatca
tacagcaggcctgttgcccaatggccttttttcaacgatttcacctccccggttctcttg
cagtttccagaatctcgtaacctccttttagggctgcagaaccagggggccctcttttcg
cagatgtctggaagcggttctacctttttcggactctttgatggggaaaaaacggccctt
cgggcctttgaaagactaaaatccatgggctatcgttgtcatcttggaaaaatgcttgcg
cgcccgtatgacccggtttacaatgggcgataa

DBGET integrated database retrieval system