KEGG   Spirochaeta smaragdinae: Spirs_1858Help
Entry
Spirs_1858        CDS       T01287                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spirs_1858
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_1858
   00052 Galactose metabolism
    Spirs_1858
   00500 Starch and sucrose metabolism
    Spirs_1858
   00520 Amino sugar and nucleotide sugar metabolism
    Spirs_1858
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Spirs_1858
   00524 Butirosin and neomycin biosynthesis
    Spirs_1858
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Spirs_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2015633..2016550)
Genome map
AA seq 305 aa AA seqDB search
MNYGIGIDLGGTLIKAVVMQENRVILKNYLWETNDHFESLQQGAPIWAQRIRQGISKIKS
EQGRDPSWIGISSPGLADTNNKRITAMPGRLLGLENLDWEVYLDSPGKIFVLNDAQAALY
GEVQLGAAKGRKDVIMLTLGTGVGGAIMLDGKLFQGRLGRAGHIGHLSVNYKGGPDICGT
PGSIDTYIGDNSISERTEGRISSTKILVERYRQNDPYATSIWLESVRALAAAIASLINIL
DPEAIIIGGGIAKAGKDLFIPLHNFLDQFEWRPNGERVSLIIPNLKDYAGAIGASCFAKD
SHQGM
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgggataggcattgatttgggaggaacgctcattaaggcagtagtaatgcag
gaaaatcgggtgatcctgaaaaactatctgtgggagacgaacgatcatttcgagagcctt
cagcaaggagccccaatatgggcacagcgtattcgccaagggataagcaaaattaaaagc
gaacagggtcgtgatccatcgtggatcggtatttcatctcccgggcttgcagatacaaac
aacaaaagaattacagcgatgccaggccgtctccttggtttggaaaacttagactgggaa
gtctacctcgattctcccgggaaaatttttgtccttaacgacgcacaagctgctctttac
ggggaagtgcagcttggtgctgcaaaaggacgaaaagatgttatcatgctcactcttgga
actggagtcggtggagcgattatgctcgacgggaaattatttcaagggaggttgggaaga
gccggccatattgggcacctcagtgtaaattacaaaggaggccccgatatttgcggtact
cccggtagtatcgatacttatataggagataactctatttccgaacgaacagaaggacgc
attagctcgacaaaaatactcgtcgagcgttatcgacagaatgatccgtatgcaacttcg
atctggcttgaatcagtcagggctcttgcggcggcaattgcttcactcatcaatattctt
gatccagaagcaattatcatcggcgggggaattgcaaaggctggtaaggatttatttata
ccattacataatttcctcgatcagtttgaatggagacctaacggcgaacgagtgtcgctc
atcatacccaatctgaaagattatgcaggggcaataggcgcatcctgttttgcaaaggat
agccatcaaggcatgtga

DBGET integrated database retrieval system