KEGG   Spirochaeta smaragdinae: Spirs_2016Help
Entry
Spirs_2016        CDS       T01287                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2165422..2166030
Genome map
AA seq 202 aa AA seqDB search
MIESLTGTITGRQGTVLFLSTGAIEWALEATSSAAMKFASSKETVQIPVHLIHREDAMLL
FAFASKKERNLFRELLKVSGIGPKQAVRILSGMEADRFIAALENEDVDLLSSIPGVGKKS
AGKIILALRGKLTPAEEEGEAGDESLPFKELVEALNGMGFDRKLAEKALKAALNELEPER
FEHDHEKLERELFRAAIVRLSS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatagagagcttaacgggcacgataacgggaaggcagggtaccgtactctttttatct
accggggcaatcgaatgggcccttgaagccacctcatcggctgcaatgaaatttgcctcc
tcaaaggaaaccgtacaaattcccgttcaccttatccatcgtgaagatgctatgttgctc
tttgcttttgcatcaaaaaaggaacggaacctttttcgcgagcttttaaaggtatcgggg
ataggtcccaaacaggcagtaaggattttatcggggatggaagccgatcgttttattgcc
gcccttgaaaatgaagatgtggatctgctttcctccatccccggagtcggaaaaaagagt
gcggggaagattattcttgcccttcgtggtaagcttacgcctgcggaagaagagggggag
gcaggagatgagagccttcccttcaaggagcttgtggaggcccttaacggtatgggattc
gaccgtaagcttgcagaaaaggctttaaaggcggctttgaacgaattagaacccgagcgc
tttgaacatgatcatgaaaaacttgaacgagagctctttagggcggcaattgtgaggcta
agcagctaa

DBGET integrated database retrieval system