KEGG   Spirochaeta smaragdinae: Spirs_2148Help
Entry
Spirs_2148        CDS       T01287                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltrans ferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ssm  Spirochaeta smaragdinae
Brite
Enzymes [BR:ssm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Spirs_2148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2316900..2317649
Genome map
AA seq 249 aa AA seqDB search
MSDLHRKSFSIFFFITLSALSVVSLFVTGGLWAQQQTETHSLVESVRENHFISEAMARAI
AAVPRGRFFPETLADFIDEDRPLPDSDAGITPAPSFVAVILDHLEIGKGTRLLIIGRGGG
YTAAVAATLGADVLLIEESKGAARYRAILNELELPVTVIEGSWNDEAVQNRLNREKGKFD
ALFVHAGVDQIPEQMSSLLAPRGAAAFPFNDNDGMQNCIIYKKEEEPSFSIEHVPQTIFE
MLENPWSLL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcttcatcggaaaagcttttccatattttttttcattacgttatcggcgtta
tcggtagtttcattgtttgtcacaggtggactgtgggctcagcagcagacagaaacgcat
tcccttgttgaatccgtcagggaaaatcactttatcagtgaagcaatggctcgcgccatt
gctgcggttccaagaggtcgctttttccccgaaacccttgccgattttatcgatgaagat
cgtccccttcctgattcagatgcagggattactccggccccctcttttgttgctgtgatt
ttggatcatttggaaataggcaagggaacgaggctgctgatcatcggaagaggaggagga
tatacggccgccgttgcagcgacgctgggtgctgatgtgctgttgatcgaagaaagcaaa
ggtgcggcacgttatcgtgcaattctgaatgaactggaacttcccgttaccgttattgag
ggaagttggaacgacgaagccgtacaaaaccgtcttaaccgtgaaaagggaaaattcgat
gccctctttgttcatgccggggtcgatcagatacccgaacagatgtcgtctcttcttgct
ccaaggggggcggcagcctttccttttaacgataatgacggcatgcagaattgcatcatt
tacaaaaaagaggaggagccaagcttctctatcgagcatgtgccgcaaaccatttttgag
atgctggaaaatccatggtcgcttttataa

DBGET integrated database retrieval system