KEGG   Spirochaeta smaragdinae: Spirs_2315Help
Entry
Spirs_2315        CDS       T01287                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spirs_2315
Enzymes [BR:ssm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Spirs_2315
Peptidases [BR:ssm01002]
 Cysteine Peptidases
  Family C44
   Spirs_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2475735..2477237
Genome map
AA seq 500 aa AA seqDB search
MCGICGIWNAEERPMVETMVERMHHRGPDEEGFYDCANGTLGHARLSIMDPTGGHQPIFN
EDKSLAVIANGEIYNYPKLRKKLASKHSFKTNNDSEVLLHLFEEEGPEMVKQLDGMFAFC
ITNGKSIFLARDPIGIKPLYWGRKKTGKVLFTSEQKTSAGEDCLLSEFPPGCTYSTTRGM
ERYFTLASKQAEQLPIKQHVSLLRNDLDKAVHKRLMSDVPVGCFLSGGLDSSIISAIVAQ
EKPDLHTFSVGLEGSSDLEAAKLVASHIGSKHHQYIITKEEIVAELPRIIYHLESFDQDL
VRSSIPTYFTAKLAAQEVKVILTGEGADELFGGYTYYRSIPDHAQLHKELLRSIKTLHNI
NLQRVDRITMAHSIEARVPFLDLKVIETAQRIPVELKLNGKPPVEKWILRKAYEKLLPEK
IVWRPKEQFDEGTGMTDLLPQLTSELFSDAQTARLIKKYPEARLRSKEEAYYFFLFQNLF
HHDEQMVRQVARWGERPNLE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatatgcggcatatggaatgcagaagaaagaccaatggtggaaacgatggta
gagcgtatgcaccataggggaccagatgaagagggattttacgactgtgcaaacggaacg
ctcggtcatgcacgtctttcaattatggatccgacaggggggcaccaacctatttttaac
gaggacaagagtctggcggtcattgcaaatggagagatctacaactatccgaagctaagg
aagaaacttgctagcaagcatagcttcaaaaccaataacgacagcgaagtgctcttgcat
cttttcgaagaagagggtcccgaaatggtaaaacagcttgatggaatgtttgccttttgc
atcaccaatggaaagtcgatcttcttagctcgagatcccatcggcataaagcctctttac
tggggtcggaaaaaaacgggaaaggtactattcacatctgaacaaaaaacaagtgcagga
gaggattgcctcctctcagaatttcctcctggttgtacctattccacaacaagagggatg
gaacgctattttaccctggcttcaaaacaagccgaacagcttcccattaaacagcatgta
tcactgctgcgcaatgatctcgacaaagcagtacataaacgactgatgagcgatgtacca
gtgggttgttttttatccggaggactcgatagcagcatcatatcggccatagttgcccag
gaaaagccggacctccacactttttcggttggtctcgagggaagcagcgatcttgaagcc
gccaaacttgttgcctcacatataggatcgaagcatcatcaatatatcatcaccaaagaa
gaaatcgtggctgagctgccacgtattatctatcatctggaatcatttgaccaagatctg
gtacgaagctctattcccacctatttcaccgcaaaactggccgctcaagaggtcaaggtg
attctgacaggggaaggagccgatgaacttttcggaggttatacctattacaggtcgatc
cccgaccatgcacaacttcataaggaactactgcgatcaatcaaaactcttcataatatc
aacctacaacgggttgatcgtattactatggcccattctatcgaggcaagagttcccttt
ctcgatttaaaagtaatcgaaacggcacagcgcattcccgtagaactgaaattgaacgga
aagcccccggtcgaaaagtggatattacgaaaagcatatgaaaaacttttaccagaaaaa
atcgtgtggagaccaaaagaacaattcgacgaagggacgggaatgaccgaccttttgccg
caattgacatccgagcttttctcggatgcacaaacagcaaggctcataaaaaaatatccc
gaggctcggctacgatcgaaagaagaggcctattacttcttccttttccagaatcttttt
catcatgatgaacaaatggtgcggcaggtcgcccgctggggagagcgtcccaatcttgag
taa

DBGET integrated database retrieval system