KEGG   Sediminispirochaeta smaragdinae: Spirs_2336Help
Entry
Spirs_2336        CDS       T01287                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00010  Glycolysis / Gluconeogenesis
ssm00052  Galactose metabolism
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01120  Microbial metabolism in diverse environments
ssm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_2336
   00052 Galactose metabolism
    Spirs_2336
Enzymes [BR:ssm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Spirs_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim HCV_core
Motif
Other DBs
NCBI-ProteinID: ADK81451
UniProt: E1R1S5
Position
2502402..2503433
Genome map
AA seq 343 aa AA seqDB search
MKLERNPFGITSDGKAVDSITMENANGIRCTFITYGASLTSFRMPDRSGHIDELTLGFDD
LASYEGNHPYYGATVGRFANRIAKGNFSIDGIGYKIDINEPPNHLHGGKEGFSRKIWEMF
PIRREKEAGATFTLTSEDGDAGFPGTVDVSLTVLLTEGNELIFSYTAVSDKPTPINLTNH
SYWNLAGSCSGPIYDHILTLHSDAFLEPDEKLIPTGRKINVANTPFDFRSPKAIGRDIEA
AGGYDHCFILSHEHALSIPAAEVKDEKSGRSMTVLTINPGVQFYTGNMLSGQRTRDGIAA
PHSAFCLETQEFPDAMNHDNFPMAILRPGERYERKTMYLFSVE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgaacgaaatccattcggcattacctcagacggtaaggctgtagattccatc
accatggaaaacgctaacggtattcgatgtacctttatcacctacggtgcatcccttacc
agctttcgcatgccggacagatccggacatatcgacgaacttacccttggttttgatgat
cttgcatcctacgagggtaatcatccctactacggtgcgacggtaggacgttttgccaac
cgcatcgcaaaggggaacttttccattgatgggatcggttacaagatagatatcaacgaa
cctccaaaccatctccacggcgggaaagaggggttcagcaggaagatatgggagatgttt
ccgatcaggcgcgaaaaagaggccggcgctacctttaccctcaccagtgaggatggcgat
gcaggatttcccgggactgtcgatgtctcgctgaccgtgctgctcaccgaaggaaatgaa
ctgattttttcctataccgccgtcagcgataaaccgactccgatcaaccttaccaatcac
agctactggaaccttgccggctcatgtagcgggcctatctatgatcatattctcaccctg
cacagcgatgcctttctcgagccggatgaaaagctgataccaacgggtcggaaaatcaat
gtggcgaacaccccctttgactttcgtagccccaaagccatcggtcgggatatagaggcg
gcaggcggctacgatcactgtttcattcttagtcatgaacacgccctttctattcccgct
gcagaggtaaaagatgaaaaaagcggcagaagtatgactgtgttgaccatcaatccggga
gtccagttttataccggtaacatgctttccggtcagcgcactcgggacgggatcgcagcc
ccccattccgccttctgccttgaaacccaggagtttccggacgccatgaatcacgacaat
tttcccatggctatcttacgccccggcgagcgctacgaacgaaaaaccatgtatctgttc
tcggtagaatag

DBGET integrated database retrieval system