KEGG   Spirochaeta smaragdinae: Spirs_2336Help
Entry
Spirs_2336        CDS       T01287                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_2336
   00052 Galactose metabolism
    Spirs_2336
Enzymes [BR:ssm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Spirs_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2502402..2503433
Genome map
AA seq 343 aa AA seqDB search
MKLERNPFGITSDGKAVDSITMENANGIRCTFITYGASLTSFRMPDRSGHIDELTLGFDD
LASYEGNHPYYGATVGRFANRIAKGNFSIDGIGYKIDINEPPNHLHGGKEGFSRKIWEMF
PIRREKEAGATFTLTSEDGDAGFPGTVDVSLTVLLTEGNELIFSYTAVSDKPTPINLTNH
SYWNLAGSCSGPIYDHILTLHSDAFLEPDEKLIPTGRKINVANTPFDFRSPKAIGRDIEA
AGGYDHCFILSHEHALSIPAAEVKDEKSGRSMTVLTINPGVQFYTGNMLSGQRTRDGIAA
PHSAFCLETQEFPDAMNHDNFPMAILRPGERYERKTMYLFSVE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgaacgaaatccattcggcattacctcagacggtaaggctgtagattccatc
accatggaaaacgctaacggtattcgatgtacctttatcacctacggtgcatcccttacc
agctttcgcatgccggacagatccggacatatcgacgaacttacccttggttttgatgat
cttgcatcctacgagggtaatcatccctactacggtgcgacggtaggacgttttgccaac
cgcatcgcaaaggggaacttttccattgatgggatcggttacaagatagatatcaacgaa
cctccaaaccatctccacggcgggaaagaggggttcagcaggaagatatgggagatgttt
ccgatcaggcgcgaaaaagaggccggcgctacctttaccctcaccagtgaggatggcgat
gcaggatttcccgggactgtcgatgtctcgctgaccgtgctgctcaccgaaggaaatgaa
ctgattttttcctataccgccgtcagcgataaaccgactccgatcaaccttaccaatcac
agctactggaaccttgccggctcatgtagcgggcctatctatgatcatattctcaccctg
cacagcgatgcctttctcgagccggatgaaaagctgataccaacgggtcggaaaatcaat
gtggcgaacaccccctttgactttcgtagccccaaagccatcggtcgggatatagaggcg
gcaggcggctacgatcactgtttcattcttagtcatgaacacgccctttctattcccgct
gcagaggtaaaagatgaaaaaagcggcagaagtatgactgtgttgaccatcaatccggga
gtccagttttataccggtaacatgctttccggtcagcgcactcgggacgggatcgcagcc
ccccattccgccttctgccttgaaacccaggagtttccggacgccatgaatcacgacaat
tttcccatggctatcttacgccccggcgagcgctacgaacgaaaaaccatgtatctgttc
tcggtagaatag

DBGET integrated database retrieval system