KEGG   Spirochaeta smaragdinae: Spirs_2443Help
Entry
Spirs_2443        CDS       T01287                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spirs_2443
   01230 Biosynthesis of amino acids
    Spirs_2443
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_2443
   00051 Fructose and mannose metabolism
    Spirs_2443
   00562 Inositol phosphate metabolism
    Spirs_2443
Enzymes [BR:ssm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spirs_2443
Exosome [BR:ssm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spirs_2443
  Exosomal proteins of bladder cancer cells
   Spirs_2443
  Exosomal proteins of melanoma cells
   Spirs_2443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2630438..2631187)
Genome map
AA seq 249 aa AA seqDB search
MRKTFIAGNWKMHKTVSEAVALAKELVPAADGNSRYLIAPPFTALSAVGEVVKGTPLLLG
AQNMSNAESGAHTGEVSVHMLKDVGVQVVILGHSERRLIYGEKDAFINEKVKLALDNDLE
VILCVGETLEQREAGEVEQVVRTQVEGGLKGIPEGFLDKVTIAYEPVWAIGTGKTATPED
ADAVHAFIRKVIKEMYGDKAAEAMVIQYGGSVKPGNVKELMAMKNIDGALVGGAALKAET
FVPIMKYDS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaactttcattgcgggaaactggaaaatgcataagacggtctccgaggccgtt
gccttggctaaggaactggtgcctgcggcagacggaaacagccgctatctgattgctcct
ccttttaccgctctttctgctgttggcgaggtggtaaagggtacccctttactgctaggt
gctcagaatatgtcgaatgcggaatcaggagcacacacaggggaggtttccgttcacatg
ttgaaggatgtcggtgttcaggtcgttatcctgggccattccgaacgccgtctgatctat
ggtgagaaggatgcttttatcaacgaaaaggtcaagcttgccctcgacaacgatcttgaa
gtcatcctttgtgtcggtgagaccctggagcagcgggaagccggcgaggttgagcaggtc
gtacgcacccaggtcgaaggtggtctcaagggaatccccgagggatttctcgataaggtt
accattgcctatgaaccggtttgggccatcggtaccggcaagaccgcaaccccagaggat
gcagatgccgttcatgcttttatccggaaggtgatcaaagagatgtatggcgacaaggct
gccgaggccatggttatccagtacggtgggtccgtgaagccgggaaatgtgaaagagctt
atggccatgaaaaacatcgacggggctctcgtcggtggggcggccctgaaagcagagacc
ttcgtaccgatcatgaagtacgacagctaa

DBGET integrated database retrieval system