KEGG   Spirochaeta smaragdinae: Spirs_2613Help
Entry
Spirs_2613        CDS       T01287                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssm  Spirochaeta smaragdinae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ssm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2789638..2791314
Genome map
AA seq 558 aa AA seqDB search
MSNPRAVLLILLCFWLLPCFGLGALDFYDEAPAEELSKSIADAMSDEELVGQLMLVGYFG
EDPSKEIIEWVDRYEIGGIKIFGWNAGNLLKLGNAVSTLQHLSEENRFSIPLFVATDQEG
GWVRHVKGDTSVTPGNLAIGASGIAWDAYKTGYYIGKELRVLGINMNFAPTVDVYTNPKA
DVIGPRAFSSDPVKTAQLSVAYFHGMQEAGIVCTAKHYPGHGATDKDSHGTLPIINADFQ
TIWDRELVPYRFLVKEGLPAIMSGHIAYPKITGTDEPASLSKTLLTGLLREKIGFQGLII
TDDMQMNGAAVYGGVPAASLQAILAGNDMIMVSRDTDTYRKIRQHMLSAMRQSPETTAVV
REAARRVIETKLRYLRGKDAVPLHPDPREIAEQIPDADGSAFFLSQAHRSVSLIRGEAMP
LQPQEAGKVLLVGQLNAFLSIGATFFPGADSFDYDYSPFFSADPQVIKRLKQRMENYDTV
VFCIANPNSAQVLEELKGFADRIYVISVLTPIYLKDIPWVENALAVYGTGRQSIEAGFSA
LTGAFQPTGIVPVSLNTQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatccccgggccgtacttctcattctactttgtttctggctccttccctgtttc
ggccttggggcgctcgatttttatgacgaggctccagcggaagaactttcgaaatcgatt
gccgatgcgatgagcgacgaggaacttgtcggacagcttatgcttgtcggttatttcggt
gaggatccttccaaggagatcatcgaatgggtggatcgctatgagatcggcggtatcaag
attttcggctggaacgccggtaatctcctcaaactggggaacgccgtttctacgcttcaa
catttgagtgaggaaaatcgattttccatcccgcttttcgtggcaaccgaccaggagggg
ggatgggttcgtcatgtaaaaggggatacaagtgtaactcccgggaatttagccatcgga
gcttcagggattgcctgggacgcatataaaacaggttattatatcggcaaagaacttcgg
gtcctcggcatcaacatgaattttgcccctaccgtagatgtttacacaaatcccaaggcc
gacgttattggtccccgggccttttcatccgatcccgtaaaaactgctcagctctctgtt
gcctattttcacggcatgcaggaagcaggcatcgtctgcacggcaaagcactatcccggt
catggcgccacggataaggattctcacggaacccttcctatcatcaatgccgactttcaa
acgatatgggacagggagcttgtaccgtaccgatttctcgttaaggagggcctgccggcg
atcatgagcgggcatatcgcctatcccaaaataacgggcacggacgaacctgcttccttg
agtaaaaccctgcttaccgggcttctgcgggaaaaaatcggctttcaggggcttattatc
accgacgatatgcagatgaacggcgctgcagtctacggtggagtccccgcagcatcgctt
caggcaattcttgcaggtaatgacatgatcatggtgagtagagataccgatacctatcgc
aagattcgccaacacatgctttcggcaatgcgtcaatcccccgaaacaaccgcagtggtg
cgggaagctgcacgaagagtcatcgaaaccaagcttcggtatctgagaggaaaagatgcg
gttcctctccatcccgacccccgtgaaattgccgagcagattcccgatgccgacggctcc
gctttttttctttcccaggcacatcgaagtgtctctcttattcgcggcgaggcaatgccc
ttacagccacaggaagcgggtaaggtgcttcttgtcggacagttgaacgcctttctctct
ataggtgctaccttttttcccggtgccgacagctttgattatgattactcaccctttttc
agcgccgatccacaggttataaaacgcttaaaacaacgtatggaaaactacgataccgtt
gttttttgtatagcaaatcccaacagcgcccaggttctcgaagaactcaaaggctttgcc
gatcgaatttatgtcatctctgtccttacacctatttacctaaaggacattccctgggtt
gaaaacgcgcttgcggtctatggaacaggcaggcagtccatagaagcggggttttctgcc
ttaaccggggcctttcagccaacaggaatcgtaccggtttccctcaacacacaatga

DBGET integrated database retrieval system