KEGG   Spirochaeta smaragdinae: Spirs_3064Help
Entry
Spirs_3064        CDS       T01287                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spirs_3064
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_3064
   00052 Galactose metabolism
    Spirs_3064
   00500 Starch and sucrose metabolism
    Spirs_3064
   00520 Amino sugar and nucleotide sugar metabolism
    Spirs_3064
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Spirs_3064
   00524 Butirosin and neomycin biosynthesis
    Spirs_3064
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Spirs_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3284566..3285513
Genome map
AA seq 315 aa AA seqDB search
MALQNSTHKFFIGIDIGGTKTAVSLGDEAGNIRKKERFATADHYEEVIDQACSSVRAMLD
FASPHKVEAIGISCGGPLDPAAGIIQAPPNLPTWIDVPVVDLIARRFDLPVYLENDANAC
ALAEWYWGNGRGCRNLIFLTFGTGLGAGFILDGRLYSGTSGLAGEVGHLRLAEEGPLCYG
KAGSWEGFCSGSGMSRLYEMKFGRSLSAKEICDRAEAGDARALEVTDTTAEYLGRGLALL
VDLFNPERVIIGSIFSRSEGLFRKRMEAVMKAEALPRTFSDCKVLPAGLGEHLGDMAALG
VAIGKLRQKEGSYDR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctttacagaacagtactcacaagtttttcatcggtatcgatatcggcggcacaaaa
acggcggtttctctcggcgacgaggcggggaatattagaaaaaaggagcgctttgccacg
gccgatcactacgaagaggtgatcgatcaggcctgttcctctgtccgggccatgctggat
ttcgcctcgccgcacaaggtagaggccatagggatcagctgcggaggcccccttgatccg
gcagccggtattattcaggcaccgccgaaccttcccacctggatcgatgttccggtggtc
gacctcattgcacgacgtttcgatcttcctgtctatctggaaaacgatgcaaacgcctgt
gcccttgccgagtggtattggggtaatggaaggggatgccggaatctgatcttcctcacc
ttcgggacagggcttggagcggggttcattctcgacggacggctctattcgggaaccagc
ggccttgccggagaggtcggccatctgcggcttgccgaagagggtcctctttgttacgga
aaagcgggttcctgggaggggttctgcagcggcagcggcatgagccgtctctacgagatg
aaattcggccgcagtctcagcgctaaggagatctgcgacagggcggaagcaggagatgct
cgggccttggaggttaccgacaccaccgcagaataccttggccgggggcttgccctcctc
gtcgatcttttcaatccggagcgggtgatcatcggaagcatcttctcaagaagcgaaggc
ctgtttcgcaagcggatggaagcggtgatgaaagcggaagccctgccccgcaccttcagc
gactgcaaggtactgcctgccggacttggggaacatctcggagacatggcggccctcggt
gtcgccatcggaaaattacgccaaaaggaaggttcttatgatagatga

DBGET integrated database retrieval system