KEGG   Sediminispirochaeta smaragdinae: Spirs_3247Help
Entry
Spirs_3247        CDS       T01287                                 

Definition
(GenBank) phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00010  Glycolysis / Gluconeogenesis
ssm00030  Pentose phosphate pathway
ssm00051  Fructose and mannose metabolism
ssm00052  Galactose metabolism
ssm00680  Methane metabolism
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01120  Microbial metabolism in diverse environments
ssm01130  Biosynthesis of antibiotics
ssm01200  Carbon metabolism
ssm01230  Biosynthesis of amino acids
ssm03018  RNA degradation
Module
ssm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_3247
   00030 Pentose phosphate pathway
    Spirs_3247
   00051 Fructose and mannose metabolism
    Spirs_3247
   00052 Galactose metabolism
    Spirs_3247
  Energy metabolism
   00680 Methane metabolism
    Spirs_3247
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Spirs_3247
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spirs_3247
Protein phosphatases and associated proteins [BR:ssm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spirs_3247
Messenger RNA biogenesis [BR:ssm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Spirs_3247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat Phage_gp53
Motif
Other DBs
NCBI-ProteinID: ADK82345
UniProt: E1R5L7
Position
complement(3484210..3485580)
Genome map
AA seq 456 aa AA seqDB search
MPDDFDFSVPSLGEPNIQSPIKMSTVKGDSIANYVSDSERILFEIDAAAGDTRGPFKTEE
LLERAGPREKVYFNPAHVHAAVVTCGGLCPGLNNVVRAIVRCLWYSYGIKRITGIKNGYR
GFLSESNFSTLELDPEYVDDIQARGGTVLGSARGGGDRVGEIADAIERLNINMLFTIGGD
GTQRGALEIAEELERRALRVSVIGIPKTIDNDLSFIQRSFGFETAVEKAVDVVRGAHVEA
HDTINGIGLVKVMGRESGFIAAYAALAMSDVNFCLIPESPFDLDGPNGLFESLRKRLLDR
NHAVILVAEGAGQELVSETGETDLSGNKRLADIGVFLKEKIKAYFISIDMEVNIKYIDPS
YIIRSSPANPNDSIYCSRLGAHAVHAAMAGKTKTLMSMVNNTFVHLPMRVAVSKRKHVNT
EGSLWRDVVENTRQPVNMCDKGEKAHEKGMKQEGKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgccagatgatttcgatttttccgttccctcgcttggtgaacctaatatacagtcgccg
attaaaatgtcgacggtcaaaggtgattccattgccaactatgtcagtgattccgagcgg
atcctttttgagattgatgcggcagccggtgataccagggggccttttaagaccgaagag
cttctggagcgtgcaggaccgcgggagaaggtctactttaatcctgcgcatgtccatgcc
gctgttgtcacctgtggagggctatgccccggcttgaacaatgttgtcagggccatcgtc
cggtgtctttggtacagctatggcataaagcgtattaccggcatcaaaaacgggtatcgt
ggttttctttccgaaagtaatttcagtaccctagagcttgatcccgagtatgtcgatgat
attcaggcccgaggcggtaccgttctcggctcggcccggggcggtggagacagggtcggg
gaaattgccgatgccattgaacgactaaatattaatatgctttttaccattggaggcgat
ggtacccaacggggggcccttgagattgccgaggaattggaacggcgagctttgcgggtt
tccgtgattggcattccgaagactatcgataatgatctctcctttattcagcgctctttc
gggtttgaaacggcggtggagaaggctgtcgatgttgttcgaggtgcccatgtcgaagca
cacgataccatcaatggtatcggcttggtgaaagtgatgggccgagagagcgggtttatt
gcagcctatgccgcgcttgccatgagtgatgttaatttttgccttattcccgagagcccc
tttgatctggatggcccgaacggcctttttgaaagcctgcgaaaacgcctacttgatcga
aatcatgcagtcattcttgttgcagagggagccggacaggagcttgtttcggaaaccgga
gagacagatctctccggcaataagcgtcttgccgatatcggggtgttcttgaaggaaaaa
atcaaggcatactttatatccatcgacatggaagtaaatattaagtatatcgatcccagt
tacattattcgaagttctccggccaacccaaacgattcgatttactgcagcagactgggc
gcccacgcggtccatgcggccatggccggtaagacgaaaaccttgatgagcatggtaaac
aatacctttgtccatcttcccatgcgggttgcggtttccaaacgtaaacacgtcaatacc
gaagggagtctgtggcgtgatgtggttgaaaatactcggcagccggttaatatgtgtgac
aagggcgaaaaagcacatgaaaagggtatgaagcaggaagggaagaagtaa

DBGET integrated database retrieval system