KEGG   Spirochaeta smaragdinae: Spirs_3541Help
Entry
Spirs_3541        CDS       T01287                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spirs_3541
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Spirs_3541
Exosome [BR:ssm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spirs_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3812192..3813694)
Genome map
AA seq 500 aa AA seqDB search
MAKKYVMAFDAGTTSNRAILFDHEGQIVSVAQQEFPQIFPKPGWVEHNPMEIWGTQSGVA
RAVLNKAGIQPDEVAAIGITNQRETAIVWEKKTGKPIMNGIVWQDRRTAGICDKMKAAGL
SDYVRDTTGLVIDAYFSGTKVKWMLDNVPGAREKAENGELLFGTVDTWIIWNLTGGEAHV
TDYSNASRTLMFNIKKLEWDERMLKELGVPRSMLPEVRPSSEVYGYTAEKTFGGAKIPVA
AAIGDQQGALFGQACFEKGMAKNTYGTGSFVLMNTGTKPMASNTGLATTIAWGLNGKVDY
ALEGSIFVTGAAVQWLRDELKIVSDAADTNYFAQKVKDTNGVYMVPAFVGLGAPYWDQYA
RGAIVGLTRGANRDHIVRATLESIAYQTRDVVECLEKDSGIETKELKVDGGASMNNFLMQ
FQADILNVPVLRPKIVETTARGSAFLAGLAVGFWKDQKDLQNAFELDRRFDPALGEADRN
RLYKGWQKAVEKAKKWEDEA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaaatatgtgatggcgtttgatgcaggtacgacgagcaaccgggcgatcctt
tttgatcacgaggggcaaatcgtaagcgtcgctcagcaggagttcccgcagatcttcccg
aaaccgggttgggtggaacacaatccgatggaaatctggggtacccagagtggtgttgcc
cgggccgtgctcaataaagccggtatccagccggatgaggttgccgcgatcggtatcacc
aatcagcgtgaaaccgccattgtctgggaaaaaaagacaggcaaaccgatcatgaacggc
atcgtttggcaggaccgccgaactgccggtatctgcgataaaatgaaggccgccggactt
tccgactatgtccgggataccacgggacttgttatcgatgcatacttttcaggaacgaag
gtaaagtggatgcttgataatgttcccggtgcacgtgagaaggcggagaacggcgaactt
cttttcggcacagttgatacatggatcatctggaaccttaccggtggagaggcccatgtg
accgattactccaatgcctcccgaacgctgatgttcaatatcaaaaaacttgaatgggat
gaaaggatgttgaaagagcttggggtgcctcgctcaatgctccctgaagttcgcccttcc
agtgaggtttatggttatactgccgagaaaaccttcggtggagcaaagatccccgttgct
gctgccattggtgatcagcagggtgctctcttcgggcaggcctgttttgagaaaggtatg
gcaaagaacacctatggtaccggaagtttcgtcttaatgaataccggaacgaaacctatg
gcttccaataccggactggcgacaaccatcgcatggggattaaacggaaaggtagactac
gcacttgaaggttctattttcgtaactggcgcagccgtacagtggctccgtgacgaattg
aagattgtctccgatgcggctgataccaactactttgctcaaaaagtgaaagatacgaat
ggtgtctacatggttcctgcgtttgtcggacttggggctccctattgggatcagtatgcc
cgtggcgcgatcgtcggtctgacaaggggtgcaaacagggatcatattgtccgtgcgact
cttgaatcgattgcctatcagacacgagacgtcgtcgagtgtcttgaaaaggactccggc
atcgagaccaaagaacttaaggtcgacggcggtgcgagcatgaataacttcctcatgcag
tttcaggccgacatcctcaatgtccctgttctcaggccgaagatcgtggaaacgaccgcg
cgcgggtctgcgttccttgccggtcttgcagtaggtttctggaaagatcagaaggatctt
cagaacgcgtttgaactggatcgaagatttgatcctgctcttggtgaggcggatcggaat
cggctctataagggctggcagaaggctgtggaaaaagcaaaaaagtgggaagacgaagcg
taa

DBGET integrated database retrieval system