KEGG   Spirochaeta smaragdinae: Spirs_3564Help
Entry
Spirs_3564        CDS       T01287                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spirs_3564
   01230 Biosynthesis of amino acids
    Spirs_3564
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_3564
   00030 Pentose phosphate pathway
    Spirs_3564
   00051 Fructose and mannose metabolism
    Spirs_3564
   00052 Galactose metabolism
    Spirs_3564
  Energy metabolism
   00680 Methane metabolism
    Spirs_3564
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spirs_3564
Protein phosphatases and associated proteins [BR:ssm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spirs_3564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3835666..3836847)
Genome map
AA seq 393 aa AA seqDB search
MKGNILIGQSGGPTSVINASLAGAVEGVLEAGARGKIFGMQFGIEGFLEDRLIDLGALSS
DERKLLALTPSSALGSCRYKLKDDDLPVILERLKKQDIRYLFLAGGNDTMDTIHRIEAFA
RKEGYELYGVGIPKTVDNDLFGTDHTPGYGSAARYTALSLLQSGQLARDMQRVDRFVIHQ
TVGREAGWLAASSIMAKQGEGDAPHLIYLPERPLSREQVLKDVQECIKAYGFCSIVCGEG
IIWRDGTPVSASAAKDGFSNIEFGAMGGTSAAISLHQLIHEETGYRGEFQITESLSMCAD
DRASATDRSEAFSCGLEAARLAASGGSGSMICMERLAGDYAVRYGTVPLSEVAVRAKPMP
DHYINESGNGVTDAFLDYLRPLVGDMPKYQRLW
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaatattcttatcggacaatcgggcggcccaacctcagtcatcaacgcttcc
cttgcgggagcggtggagggagtgcttgaggccggagcgaggggcaagatattcggcatg
caattcggtatcgagggctttctggaggatcgtctcatcgaccttggggctctgtcttcc
gatgaacggaaattgctggcgctcaccccctcttccgccctcggctcgtgccgttacaaa
ttaaaagacgatgacctgccggttattctcgagcgactgaaaaaacaggatatacgctat
ctttttcttgccggtgggaacgacaccatggacaccatccacagaatagaggcctttgcc
cgtaaagagggctatgaactctacggagtcggcatcccgaagaccgtggataatgatctt
tttggtacggatcacacccccggctacggctctgctgccagatacaccgccctttctctc
cttcagtcggggcagcttgccagggacatgcagcgggtcgatcgttttgtgatccaccag
accgtcggacgggaagcgggatggcttgccgcatcgtcgataatggcgaagcagggtgag
ggagatgctccccatcttatctatctgccggaacggcccttgtccagggagcaggttttg
aaagatgtacaagaatgcatcaaggcctacggattttgttcgatcgtctgcggagagggc
atcatctggcgtgacgggacccctgtttcggcctctgccgcgaaggacgggttttcaaat
atcgagtttggggccatgggcggtaccagcgccgctatctcgcttcatcagctgatccat
gaggagaccggctaccggggagagttccagatcaccgaaagcctttccatgtgtgccgat
gaccgggcaagtgccaccgatcgaagcgaggccttttcctgtgggcttgaggctgcaagg
cttgcggcctccggcggaagcggaagcatgatttgcatggagcgccttgccggggattat
gccgtccgatacggtactgtccccttatccgaggtcgctgtacgggcaaagcccatgccg
gatcactatatcaatgagtcgggaaacggggtcaccgatgcctttctcgactaccttcgc
ccccttgtgggcgatatgccgaagtatcagcgattgtggtag

DBGET integrated database retrieval system