KEGG   Spirochaeta smaragdinae: Spirs_3658Help
Entry
Spirs_3658        CDS       T01287                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spirs_3658
   01230 Biosynthesis of amino acids
    Spirs_3658
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_3658
  Energy metabolism
   00680 Methane metabolism
    Spirs_3658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_3658
Enzymes [BR:ssm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spirs_3658
Exosome [BR:ssm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spirs_3658
  Exosomal proteins of melanoma cells
   Spirs_3658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3940502..3941251
Genome map
AA seq 249 aa AA seqDB search
MGPLQLVLIRHGESQWNKENRFTGWTDVPLSEKGKKEAQAGGRLLREEGFVFDKAYTSVL
KRAIKTLWIVLEEMDLMWIPVVRAWELNERHYGGLQGLNKSETAKKYGEEQVLIWRRSYD
TPPPELTKESAYYPGKDLKYRELSEEQIPLTESLKITIERVVPYWEKVIVPELKAGKRLL
IAAHGNSLRALVKYLDGISNEEITKLNIPTGVPLVYELDKDITPIRHYYLGDQEAIQAKM
AAVANQGKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggaccccttcaattagtccttatccgtcatggtgaaagccaatggaataaagaaaat
aggttcaccggttggaccgatgtacccttatcggaaaagggaaaaaaggaggcacaagcg
ggtggcaggttattgcgtgaagaaggttttgtcttcgataaggcctacacctccgttctg
aagcgtgccatcaagaccctctggatcgtcctcgaagagatggatctcatgtggatcccc
gttgttcgggcatgggaactgaatgagcgacactacggaggattacaggggctgaacaaa
tcggaaacggcaaaaaagtacggagaagaacaggttctgatctggcgacgcagctatgac
accccgcctcccgaattgacaaaagagagcgcatactatccgggaaaggatctaaaatat
cgggaactctcggaagaacagatacccttaaccgaaagcctcaaaatcaccatagagcgg
gtcgtaccctactgggaaaaggtgatagtccccgaactgaaggcgggaaagcgtctcttg
atagcggcccacggcaatagtctgcgagcattggtcaaataccttgacggcatctcgaac
gaagagatcacaaaactcaacattccgaccggagttccgttggtctacgagctggataag
gatataacaccaatccgccactactatttgggagaccaagaggccattcaggccaaaatg
gccgcagtggcaaatcagggcaaaaagtaa

DBGET integrated database retrieval system