KEGG   Sediminispirochaeta smaragdinae: Spirs_3658Help
Entry
Spirs_3658        CDS       T01287                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00010  Glycolysis / Gluconeogenesis
ssm00260  Glycine, serine and threonine metabolism
ssm00680  Methane metabolism
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01120  Microbial metabolism in diverse environments
ssm01130  Biosynthesis of antibiotics
ssm01200  Carbon metabolism
ssm01230  Biosynthesis of amino acids
Module
ssm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_3658
  Energy metabolism
   00680 Methane metabolism
    Spirs_3658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_3658
Enzymes [BR:ssm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spirs_3658
Membrane trafficking [BR:ssm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Spirs_3658
Exosome [BR:ssm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spirs_3658
  Exosomal proteins of melanoma cells
   Spirs_3658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADK82744
UniProt: E1R7N9
Position
3940502..3941251
Genome map
AA seq 249 aa AA seqDB search
MGPLQLVLIRHGESQWNKENRFTGWTDVPLSEKGKKEAQAGGRLLREEGFVFDKAYTSVL
KRAIKTLWIVLEEMDLMWIPVVRAWELNERHYGGLQGLNKSETAKKYGEEQVLIWRRSYD
TPPPELTKESAYYPGKDLKYRELSEEQIPLTESLKITIERVVPYWEKVIVPELKAGKRLL
IAAHGNSLRALVKYLDGISNEEITKLNIPTGVPLVYELDKDITPIRHYYLGDQEAIQAKM
AAVANQGKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggaccccttcaattagtccttatccgtcatggtgaaagccaatggaataaagaaaat
aggttcaccggttggaccgatgtacccttatcggaaaagggaaaaaaggaggcacaagcg
ggtggcaggttattgcgtgaagaaggttttgtcttcgataaggcctacacctccgttctg
aagcgtgccatcaagaccctctggatcgtcctcgaagagatggatctcatgtggatcccc
gttgttcgggcatgggaactgaatgagcgacactacggaggattacaggggctgaacaaa
tcggaaacggcaaaaaagtacggagaagaacaggttctgatctggcgacgcagctatgac
accccgcctcccgaattgacaaaagagagcgcatactatccgggaaaggatctaaaatat
cgggaactctcggaagaacagatacccttaaccgaaagcctcaaaatcaccatagagcgg
gtcgtaccctactgggaaaaggtgatagtccccgaactgaaggcgggaaagcgtctcttg
atagcggcccacggcaatagtctgcgagcattggtcaaataccttgacggcatctcgaac
gaagagatcacaaaactcaacattccgaccggagttccgttggtctacgagctggataag
gatataacaccaatccgccactactatttgggagaccaagaggccattcaggccaaaatg
gccgcagtggcaaatcagggcaaaaagtaa

DBGET integrated database retrieval system