KEGG   Spirochaeta smaragdinae: Spirs_3786Help
Entry
Spirs_3786        CDS       T01287                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spirs_3786
   00051 Fructose and mannose metabolism
    Spirs_3786
Enzymes [BR:ssm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Spirs_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4079802..4081142
Genome map
AA seq 446 aa AA seqDB search
MKDYFIGNKEYFPGIGKIAYEGAGTDNPLAFRFYDPDKKIGNKTMREHLRFSIAYWHSFC
AGGNDPFGADTHHFPWAVKADPMEAAKDKVDAAFEFITKIDAPFYCFHDRDLAPEGKSIA
ESEKNLMELAGMAKERQEATGVKLLWGTANLFNHPRFMNGAATNPNFDVIPFAAAQVKAA
IDATILLGGGGYVFWGGREGYMSLLNTDMKREKEHLLRFLTAARDYGRKAGFKGTFMIEP
KPMEPTKHQYDYDAETVAAFIKTNGLEKDFAINIENNHATLAGHTFWHDLQVAADNGLLG
SVDANQGDYQNGWDTDQFPSNVYETARAMMVILENGGFTYGGLNFDAKRRRNSTDPADLF
YAHIGGMDAFALGLEIAYNINTKSELPKRKSTRYASFDSGKGAEFEAGKLSLEELRNIAL
DAREPETISGNQELLENILNRYMFVR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaagactattttatcggcaataaagagtattttccgggaatcggaaaaatagcgtat
gaaggagcgggaaccgacaaccctctcgcttttcgtttttacgatcccgacaaaaaaatc
ggaaacaagaccatgagggaacacctcaggttttccatcgcctattggcacagcttctgc
gcaggaggcaacgacccctttggagcagatacccaccactttccctgggcagtcaaggcg
gaccccatggaagcggcaaaggataaggtagatgcggcatttgaattcatcacgaagatt
gacgcccccttttactgttttcacgaccgggatcttgctcccgaagggaagagcattgcg
gaaagtgaaaaaaacctgatggagctggcaggcatggcaaaggagcgccaggaggccacc
ggtgtcaaacttttgtggggtacggcgaatctcttcaatcatccccgattcatgaatgga
gcggctaccaatcccaatttcgatgtcattccctttgccgcggcccaggtaaaggcagcc
atcgacgcaacgattctccttggcggaggaggatatgtattctggggcggacgagagggc
tacatgagccttctgaacaccgacatgaagcgggaaaaagagcacctgctccgttttctc
accgctgccagggattacggccgcaaggcaggtttcaagggaaccttcatgattgagccc
aagcccatggagccgacaaagcaccaatacgactacgatgcggaaaccgttgccgccttc
atcaaaacaaacggtctggaaaaggattttgccatcaacatcgaaaacaaccacgcgacc
ctcgccggccacacgttctggcatgacctccaggtagctgcagacaacggcctcctcggc
agtgtcgacgcgaaccagggagactatcagaatggctgggacactgaccaatttccctcg
aatgtctatgagacggcaagggcaatgatggtgatcctcgaaaacggtggattcacctac
ggaggcctcaatttcgacgccaagcgccggcgaaactccaccgatccagcagacctcttc
tatgcccatatcggcggaatggacgcctttgctctcggtctggaaatcgcctacaacatc
aatacaaaaagcgaattgcccaagcgcaaaagcacgcgctacgcctccttcgattcgggt
aagggagcggaattcgaggcgggaaagctctcccttgaagaattgcgcaacatcgctctt
gacgccagggagccggaaaccatcagcggaaatcaggaacttctggaaaatatcctgaac
cgctacatgttcgtgcgctga

DBGET integrated database retrieval system