KEGG   Spirochaeta smaragdinae: Spirs_3799Help
Entry
Spirs_3799        CDS       T01287                                 

Definition
uracil-DNA glycosylase superfamily protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ssm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4094579..4095313
Genome map
AA seq 244 aa AA seqDB search
MKQESKALQEAAKLLSRRVDSMAFNRPPGAVIYNPLDYAWEPFAAYTDRYGGGKKRTLFL
GMNPGPWGMAQTGVPFGEVETVKNWLGIDGRIKKPREEHPKRPIEGFDCRRSEVSGLRLW
SLMKERFHDPDDFFRDHLIVNYCPLIFLEPSGRNKTPDKLPKEERNRLQEACDIHLKQVI
EITGAEYLIGIGKYAEKAFMRVAGAMGKTIASILHPSPANPAANRGWGEQASKHLEALGV
WVCE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaggaaagtaaggcattacaggaggcggctaaactgcttagccgtcgggtggac
agtatggcattcaatcgtcccccaggggcggtgatctacaaccccctcgactatgcatgg
gagccctttgccgcctataccgaccggtacggaggcggaaaaaaaaggacactctttctc
ggaatgaatccgggtccgtggggaatggctcagaccggagtaccctttggagaggttgaa
accgttaagaactggctcggcatcgacggaaggataaagaaaccgagggaggaacatccc
aaacggccgattgagggattcgactgcaggcgaagtgaggtgagcggccttaggctctgg
agtcttatgaaagagcgatttcacgatcccgacgacttctttcgggatcatcttattgta
aactactgcccgcttatctttttggagccctcaggaagaaacaagaccccggacaagctg
ccgaaagaggaacggaatcggctgcaggaggcgtgcgatatccacttgaagcaggttatc
gagattaccggtgccgaatatctgatcggcatcggtaaatacgcggaaaaggctttcatg
cgagtagcaggtgcgatgggtaaaacgatagcctcgatccttcatccaagcccggcgaat
ccagcggcaaatcgaggatggggcgagcaggctagcaaacacttggaggccctgggggtc
tgggtctgtgaataa

DBGET integrated database retrieval system