KEGG   Spirochaeta smaragdinae: Spirs_3799Help
Entry
Spirs_3799        CDS       T01287                                 

Definition
(GenBank) Uracil-DNA glycosylase superfamily
  KO
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Spirs_3799
Enzymes [BR:ssm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Spirs_3799
DNA repair and recombination proteins [BR:ssm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Spirs_3799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4094579..4095313
Genome map
AA seq 244 aa AA seqDB search
MKQESKALQEAAKLLSRRVDSMAFNRPPGAVIYNPLDYAWEPFAAYTDRYGGGKKRTLFL
GMNPGPWGMAQTGVPFGEVETVKNWLGIDGRIKKPREEHPKRPIEGFDCRRSEVSGLRLW
SLMKERFHDPDDFFRDHLIVNYCPLIFLEPSGRNKTPDKLPKEERNRLQEACDIHLKQVI
EITGAEYLIGIGKYAEKAFMRVAGAMGKTIASILHPSPANPAANRGWGEQASKHLEALGV
WVCE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaggaaagtaaggcattacaggaggcggctaaactgcttagccgtcgggtggac
agtatggcattcaatcgtcccccaggggcggtgatctacaaccccctcgactatgcatgg
gagccctttgccgcctataccgaccggtacggaggcggaaaaaaaaggacactctttctc
ggaatgaatccgggtccgtggggaatggctcagaccggagtaccctttggagaggttgaa
accgttaagaactggctcggcatcgacggaaggataaagaaaccgagggaggaacatccc
aaacggccgattgagggattcgactgcaggcgaagtgaggtgagcggccttaggctctgg
agtcttatgaaagagcgatttcacgatcccgacgacttctttcgggatcatcttattgta
aactactgcccgcttatctttttggagccctcaggaagaaacaagaccccggacaagctg
ccgaaagaggaacggaatcggctgcaggaggcgtgcgatatccacttgaagcaggttatc
gagattaccggtgccgaatatctgatcggcatcggtaaatacgcggaaaaggctttcatg
cgagtagcaggtgcgatgggtaaaacgatagcctcgatccttcatccaagcccggcgaat
ccagcggcaaatcgaggatggggcgagcaggctagcaaacacttggaggccctgggggtc
tgggtctgtgaataa

DBGET integrated database retrieval system