KEGG   Spirochaeta smaragdinae: Spirs_3804Help
Entry
Spirs_3804        CDS       T01287                                 

Definition
carbohydrate kinase FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spirs_3804
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Spirs_3804
Exosome [BR:ssm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spirs_3804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4099286..4100833
Genome map
AA seq 515 aa AA seqDB search
MDSEQRFLLAFDAGGTTIRAIIYKEDGDELARAFRTTSEIRSEQGAVEHDPEELFQALLA
AGREVLSKAAIPPEKIAGAGITVQRATFCLWDKKSGKPQCNFISWSDVRAGDKAFKMNRS
CIWNGMKIAAAVGGFITRSPMLTATGMLSFVTDHVLVRLCWLFEQRPDLRQAAKRGDLLF
GTIETWFLYRLTGNRVHATDTSNAAATSLYNPFEMKWNAIFCRLFSIPMRMLPEVKNSAD
QFGFTDPSCFGAPIPITALIGDQMAALFGHGCFTPGDVKISQGSGSFVDINVGRRGKVSR
RGLFPLIAWTLRGKPVYMLEGSVATAGRLIDWLGNGIGLSDTPAVLNDFASQCDDTEGVV
FVPTAAGIRFPYFNPKARGTIFGLSLSTHRRHVARAVLEGIAHRVVDILEGIEKDTGMSI
RRIKVDGGVSRSNVLLQAIADLSGHEVERPDETDMTARGTAALAGLGAAVWKDVEELGSM
ARSYEHFHPRFDHNQRREKRRRWNEALNTLVKFYH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgaacaacgatttcttcttgctttcgacgcaggaggaacgacgatacgggca
attatctataaagaagacggggatgagcttgccagagccttccgaacaaccagtgagata
cggagtgagcaaggtgctgtcgagcacgatcctgaggaactttttcaggctctgctggcc
gccgggcgggaggtccttagcaaggcggccattcctcccgaaaagatagcaggggcaggc
attaccgttcaacgggccaccttttgtctctgggataaaaaaagcggaaagccgcaatgt
aactttatcagctggtcggatgtccgcgccggggacaaggccttcaaaatgaaccgatca
tgcatctggaacggcatgaaaattgccgctgccgtgggcgggttcattaccagaagccca
atgcttacggcaaccggcatgctctctttcgttaccgaccatgttctggtgaggctctgc
tggctttttgaacagcgtccggacctgaggcaggcggcaaaacgaggtgacctgcttttc
gggaccatcgaaacctggtttctctatcgccttaccggaaacagggtgcatgccaccgat
accagcaacgctgcggcaaccagtctctacaacccctttgagatgaagtggaacgccatt
ttctgcaggcttttttccattcccatgaggatgctgcccgaagtcaaaaactcggcggac
caattcggctttaccgatccatcctgcttcggtgcgcccattcccataaccgcgcttata
ggcgatcaaatggcggcccttttcggtcacggatgcttcacccccggcgatgtaaaaatc
agccagggaagcggcagcttcgtggatatcaacgtaggcaggcggggaaaggtctcccgc
agaggtctttttcccctgattgcctggaccctaaggggaaaaccggtatatatgctcgaa
ggatcggtagcaacggcgggaaggctgatcgactggctgggaaacgggatagggctctcc
gacacacccgcggtgctcaacgatttcgcctcccagtgtgatgataccgaaggggtcgtc
tttgtgccgaccgctgcgggcatccggtttccctactttaatccgaaggcacggggaacc
atcttcggactttccttgtcgacacaccgccgtcatgttgcaagggccgtactggaggga
atcgcacacagggttgtcgatattctcgagggaatcgaaaaggataccggtatgtcgatt
cgccggatcaaggtagacggcggagtgagcagaagcaatgtccttcttcaggcaattgcc
gacctctccggtcatgaagttgagcgccccgatgagaccgatatgacggcccggggaacc
gccgctcttgctggtttgggggcggcggtgtggaaggatgtggaagaactgggaagcatg
gcgaggagttacgagcactttcatcctcgtttcgaccataaccagcggagggaaaaacga
agacgctggaacgaggctcttaatacccttgttaagttttatcattag

DBGET integrated database retrieval system