KEGG   Spirochaeta smaragdinae: Spirs_3992Help
Entry
Spirs_3992        CDS       T01287                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spirs_3992
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_3992
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spirs_3992
Enzymes [BR:ssm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spirs_3992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4315815..4316951
Genome map
AA seq 378 aa AA seqDB search
MIISPKLKKDHIIGPMENRSEYQTFDLLADASNAFPEIQEAIYDAAAIASDHDRPIQERI
SAFEDIIDSEVGDTLLLRARNIEREFGLRQLYLKFEGGNPSGTQKDRIAFAHVRDAMRRG
YSGIAIATCGNYGGAMAFAARLAGLSCTAFIPQSYKTRRISEMEGYGVEIIRTPGDYEDA
VDRCREYATEKDIYDANPGDTNSVLQMEAYGQIAYELYDELRDAPAAVAIPVSNGSTLAG
IQRGFISLYRRGKTSRMPKLIAGSATKKNPIIKAFKSGLSECSDLAPDSIHESAVNEPLI
NWHSIDGDQALSSIYNSRGWAMDATDKEMVAFARIIREKEGLNVLPASTAGLIAMLKRHK
EEPLPGDRYVAILTGRKQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgatcatctcgccaaaattgaagaaagaccatataatcggccccatggaaaatcgatcg
gagtatcaaacctttgatctccttgcagacgcttcgaacgccttcccggagatccaggaa
gccatctacgatgcagcagccattgcctcagaccatgatcgtcccattcaggaacgtata
tcagcctttgaagatatcatcgattcagaagtcggagatacccttctgcttcgggcgaga
aacatcgaacgggaattcggactcaggcagctctatctaaaattcgagggaggaaatcca
tcgggaactcaaaaagaccggattgcctttgcccatgttcgcgatgcaatgcgtcgaggt
tatagtggtatcgccatagcaacttgcggaaattacggaggagccatggcctttgccgcc
cggctcgcgggactttcctgtacggcatttattcctcagagctataaaacccgtagaatt
agcgagatggaaggatacggcgtggaaatcatccgaacgccgggagactacgaagatgct
gtagaccgatgtcgggaatatgcgacggaaaaggatatctacgatgcaaacccgggagat
acaaactcagtgttacaaatggaagcctatggccagattgcctatgaattgtacgacgag
cttcgtgatgctcccgctgccgttgcaatccccgtttcaaatggatcaaccctggcggga
atacaacgcggtttcatcagtctatacagaagaggaaaaacgagtagaatgccgaaattg
atcgcaggctctgcaaccaaaaaaaacccgatcatcaaagcctttaaaagcggtctttca
gaatgttctgatcttgctcccgattcgatacatgagtcagcggttaatgaaccactgata
aactggcactctatcgatggagatcaggcactttcgtcgatttacaactccagaggttgg
gccatggatgccaccgataaggagatggttgcctttgcaaggatcattcgggagaaagag
gggctaaatgtccttcctgcgtctactgcgggtttgattgccatgttgaagcggcataaa
gaggagccgcttccgggagatcgttatgtggcaatccttactggccgtaaacagtaa

DBGET integrated database retrieval system