KEGG   Sediminispirochaeta smaragdinae: Spirs_3992Help
Entry
Spirs_3992        CDS       T01287                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00260  Glycine, serine and threonine metabolism
ssm00750  Vitamin B6 metabolism
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01120  Microbial metabolism in diverse environments
ssm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_3992
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spirs_3992
Enzymes [BR:ssm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spirs_3992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADK83077
UniProt: E1R9A8
Position
4315815..4316951
Genome map
AA seq 378 aa AA seqDB search
MIISPKLKKDHIIGPMENRSEYQTFDLLADASNAFPEIQEAIYDAAAIASDHDRPIQERI
SAFEDIIDSEVGDTLLLRARNIEREFGLRQLYLKFEGGNPSGTQKDRIAFAHVRDAMRRG
YSGIAIATCGNYGGAMAFAARLAGLSCTAFIPQSYKTRRISEMEGYGVEIIRTPGDYEDA
VDRCREYATEKDIYDANPGDTNSVLQMEAYGQIAYELYDELRDAPAAVAIPVSNGSTLAG
IQRGFISLYRRGKTSRMPKLIAGSATKKNPIIKAFKSGLSECSDLAPDSIHESAVNEPLI
NWHSIDGDQALSSIYNSRGWAMDATDKEMVAFARIIREKEGLNVLPASTAGLIAMLKRHK
EEPLPGDRYVAILTGRKQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgatcatctcgccaaaattgaagaaagaccatataatcggccccatggaaaatcgatcg
gagtatcaaacctttgatctccttgcagacgcttcgaacgccttcccggagatccaggaa
gccatctacgatgcagcagccattgcctcagaccatgatcgtcccattcaggaacgtata
tcagcctttgaagatatcatcgattcagaagtcggagatacccttctgcttcgggcgaga
aacatcgaacgggaattcggactcaggcagctctatctaaaattcgagggaggaaatcca
tcgggaactcaaaaagaccggattgcctttgcccatgttcgcgatgcaatgcgtcgaggt
tatagtggtatcgccatagcaacttgcggaaattacggaggagccatggcctttgccgcc
cggctcgcgggactttcctgtacggcatttattcctcagagctataaaacccgtagaatt
agcgagatggaaggatacggcgtggaaatcatccgaacgccgggagactacgaagatgct
gtagaccgatgtcgggaatatgcgacggaaaaggatatctacgatgcaaacccgggagat
acaaactcagtgttacaaatggaagcctatggccagattgcctatgaattgtacgacgag
cttcgtgatgctcccgctgccgttgcaatccccgtttcaaatggatcaaccctggcggga
atacaacgcggtttcatcagtctatacagaagaggaaaaacgagtagaatgccgaaattg
atcgcaggctctgcaaccaaaaaaaacccgatcatcaaagcctttaaaagcggtctttca
gaatgttctgatcttgctcccgattcgatacatgagtcagcggttaatgaaccactgata
aactggcactctatcgatggagatcaggcactttcgtcgatttacaactccagaggttgg
gccatggatgccaccgataaggagatggttgcctttgcaaggatcattcgggagaaagag
gggctaaatgtccttcctgcgtctactgcgggtttgattgccatgttgaagcggcataaa
gaggagccgcttccgggagatcgttatgtggcaatccttactggccgtaaacagtaa

DBGET integrated database retrieval system