KEGG   Spirochaeta smaragdinae: Spirs_4039Help
Entry
Spirs_4039        CDS       T01287                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spirs_4039
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Spirs_4039
Enzymes [BR:ssm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Spirs_4039
Two-component system [BR:ssm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Spirs_4039
Bacterial motility proteins [BR:ssm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Spirs_4039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4369286..4370479)
Genome map
AA seq 397 aa AA seqDB search
MDKEIVSVMICDDSALMRNLVGRMVEKAEGLELVGKAMNGKFLLQKIPRLNPDVIILDLE
MPEMNGIEFLKERKRLGIDIPVVILSSIAKRGAKITMEALSLGASDFIMKPSGSVSEDIH
LVEKQVVETVYAYGLQYRRSLSVAERKKRDQERPIPSPAERPVRKVERTIIPEILRSELV
PGAGKLEPREVASPVARQDAGPLEICAIGISTGGPNALRTVFSELPADFPLPILVVQHMP
AGFTLEFARSLDRICALEVKEAEEGDLVKRGRVLIAPGNFHIQVHRRRLAAVVSLSSADP
VNGHRPSADVLFESVAEEFGGRALAVIMTGMGRDGARKIGEIHRKGGLTIAQDAASSIVY
GMPKVAAELGHIQHIVPLSEMASVLSAKAKEFSASIP
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggataaagaaatcgtttccgtaatgatatgtgatgattcggctctgatgaggaatctt
gtcggcagaatggtggaaaaggcggaagggcttgagcttgtcgggaaagcaatgaacggc
aaattcttgctccaaaaaatcccgcggctgaaccccgatgtgattatccttgatctcgag
atgccggaaatgaacggtatcgaatttttaaaagaacgaaagcgactcggaattgatatt
cctgttgtgattctttcatccatagcgaaacgcggtgcaaagataaccatggaggcgctg
tctctcggtgcctccgactttatcatgaagccttccggttccgtcagcgaagacatccac
ctggtcgagaagcaggtggtggaaacggtgtatgcttacggcctccagtaccgccggtct
ctgtcggttgccgaaaggaaaaaacgggatcaggagcggccgatcccctctcctgccgaa
cggcccgttcgaaaagtagagcgtactatcattcctgagatcctgcgttccgaacttgtt
cccggtgccggaaaacttgaaccgagagaagtggcctctcctgttgccaggcaggatgcc
ggacctttggaaatttgtgccatcggtatctctaccggtggcccaaatgccctgcgtacc
gttttctccgagcttcctgccgatttcccccttcccattttggtcgtccagcacatgcct
gccggtttcactctggaatttgccaggagtctcgatcgaatctgcgctttggaggtcaaa
gaggccgaggaaggtgatctggtgaaacggggtagggtgcttattgcccctggtaatttt
catatccaggtgcacaggcggcgccttgcggcggtcgtttcgctttcaagcgccgatccc
gtaaacggccatcggccttctgccgatgtactttttgagtcggtggctgaagagttcgga
gggagggctcttgccgtcatcatgaccggaatgggacgtgacggggcccggaagattggc
gaaatccaccgcaaaggcggacttaccattgctcaggacgctgcttccagtatcgtatac
ggtatgccaaaggttgcggcggagctagggcatatacagcatattgtcccgcttagtgag
atggcttcggtcctttcggcaaaggcgaaagaattttccgcctctattccgtga

DBGET integrated database retrieval system