KEGG   Spirochaeta smaragdinae: Spirs_4115Help
Entry
Spirs_4115        CDS       T01287                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spirs_4115
Enzymes [BR:ssm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Spirs_4115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4446817..4448385)
Genome map
AA seq 522 aa AA seqDB search
MVGERRAGVLFHPVSLPGSYGIGDLGGEAYRFIDFLERAGITLWQVLPLGPTGYGESPYQ
CLSTFAGNPLLISIDRLLEQGDLPARMVEHIPDFPICTVDYARVRSWKEPLLRHAAGRFL
DSGNASRLEAFGEFCEEKASWLNDFALFATIKEFYDAKAEEEGVEDASWNVYWDKALALR
DAEALEAFSAGHQREIEEHMVLQFFFYEQWRELKAYANERGISIIGDIPIFVSPDSSDIW
AERHLFLTDEKAMPTHVAGVPPDYFSPTGQRWGNPLYDWDAMRKEGFSWWIHRIQAMLNV
VDIIRIDHFRGFEAYWKIPVKEKTAVKGTWVKAPGKELFDAVIKRLGPIPILAEDLGVIT
PEVVGLRDRYAFPGMKVLQFAFEHDRDGNLTATNGFLPHTYDKNCVVYTGTHDNDTTLGW
YRSINDTERDLVRRYLARPDDDIVWDLIRTAYASVAKYAIIPMQDFLVLNTDARMNLPST
IGGNWSWRMTPGVANDWVAGRARELAWLYGRLPRPKQPRPEE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggttggggaacgaagagcgggagttctttttcacccggtttctctaccgggctcttat
ggaatcggagatttgggcggtgaagcatatcgttttatcgattttctggaacgggctggt
atcactctttggcaggttcttcccctggggcctaccggttatggtgagtcgccgtaccag
tgcctttcgacatttgccggcaaccctttgctgatcagcatcgatcgccttctcgaacag
ggggatcttcctgctcggatggtggagcatattccggattttcccatatgcaccgtggat
tatgcacgggtacgttcctggaaggagcccctgcttcgtcacgcggccggccgttttctc
gacagtggcaatgcaagtcgtttggaagcctttggcgaattttgcgaagagaaggcctca
tggctcaatgatttcgctctttttgcaaccatcaaggaattctacgatgcaaaagccgaa
gaagagggtgtcgaggatgcaagctggaacgtctactgggataaagcccttgcgctaagg
gatgccgaggcattggaggccttttcagccgggcatcagcgagagattgaagaacacatg
gtccttcagttcttcttctatgaacagtggcgagagctcaaggcctatgccaacgagcgg
ggaatttccatcatcggggatattcccatttttgtaagtcccgacagttcggatatctgg
gccgaacgccaccttttcttaaccgatgaaaaagctatgcctacgcatgttgcaggagtc
ccaccggactatttctctcctacgggacagcgatggggaaatcccctctatgattgggat
gccatgagaaaagaggggttctcctggtggattcaccgtattcaggcgatgctcaatgtg
gtcgacatcattcgtatcgaccatttccggggctttgaagcctactggaagatccctgtc
aaggagaagaccgcggtcaaaggtacatgggtcaaggctccggggaaagaactcttcgat
gcggtaataaagcgtctcggccccatccccatccttgccgaagaccttggtgtcattact
ccggaggtggttgggcttcgggaccgttacgcattccccggcatgaaggttctgcagttt
gcctttgagcatgaccgcgacgggaatcttaccgcgacaaacggattcttgcctcatacc
tatgataaaaactgcgtagtgtataccggtactcacgacaacgataccaccctcggctgg
tatcgttctatcaacgatacggagcgggatttagtccgtcgttatttggcccgtccggac
gacgatattgtctgggacctgatcaggaccgcctatgcttcggtggcgaagtatgcaatc
attcccatgcaggatttcttggttttgaataccgatgccagaatgaatcttccgtcgacg
atcgggggaaactggagttggcgcatgacccccggagtggccaacgactgggtcgccggc
cgggcccgggagcttgcatggctgtacggacggcttccccggcctaaacaaccccgtccg
gaagaatga

DBGET integrated database retrieval system