KEGG   Spirochaeta smaragdinae: Spirs_4123Help
Entry
Spirs_4123        CDS       T01287                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spirs_4123
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_4123
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spirs_4123
Enzymes [BR:ssm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spirs_4123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4455736..4456989
Genome map
AA seq 417 aa AA seqDB search
MNREDSKKSGYFGRFGGAYVAEVLRPALLELETAFGKAMKDQSFLAELDRIGKEYIGRPT
PLLHAKNASRAIGGAEMYIKLEGLANTGAHKINNAVGQAMLAKRMGKTRIIAETGAGQHG
LATAAACARLGLECVIYMGEKDHRRQRPNVMYMEFFGATVIPVKGGSGTLKDAVNEALRD
WAGSFSNTHYLIGSALGPAPFPAIVKAFQSVIGRETEQQLSEAGVKADLLVACVGGGSNS
IGFFSPWIDEPTLNEHLKTRLLGAEAGGKGRAPGEHAARMDGSGKEGIFQGYKSLFLLDE
DGQVYGTHSISAGLDYPGIGPRLAWEHEQGRIEFTRVSDEQALEALRFFAKTEGTLFALE
SAHAGYAAMQEAKRLGPGKVIVINMSGRGDKDLFITAANEKPKEWAEFLRREAEALS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagaggattcgaagaagtcaggatacttcggtcgctttggaggagcatatgtt
gccgaagtgttgagaccggcccttctggagcttgagacagcctttggcaaggctatgaag
gatcagagtttcctcgcagagcttgataggatcgggaaagagtatatcggccgtccgacc
cccctactccatgccaaaaacgccagccgggctatcggcggggccgagatgtacattaaa
cttgagggtttggccaacaccggagcccataagatcaacaacgccgtgggacaggccatg
cttgcaaagcgaatgggcaagacgcgcatcatcgccgaaacaggggcaggccaacatggt
cttgccactgcagctgcttgtgcacgcctcggtttggaatgtgtcatttatatgggggag
aaagaccataggcgtcagcgtcctaatgttatgtatatggagtttttcggcgctacggtt
atccccgtaaagggcggttccgggacccttaaggatgcggtaaacgaggcccttcgggac
tgggccggaagtttttcaaacacccactaccttatcgggtcggcactgggtcctgccccc
tttccagcaattgtaaaagcgtttcagtccgtcattggaagggaaaccgagcagcaactc
tcggaggccggggtaaaagccgaccttctggtcgcatgtgtcgggggcgggagcaattcc
atcggcttcttctctccctggatagatgagccgaccttgaatgagcacctaaagaccagg
ctattgggagcagaagcaggaggaaagggcagggccccaggagagcacgcagcacgtatg
gacggctcaggaaaggaaggaatctttcagggctacaagagcctctttctccttgacgaa
gacggtcaggtctacggtacccactccatcagcgccggtctcgattacccgggcatcggc
ccacggctcgcctgggagcatgaacagggcaggatcgaatttacgagggtaagcgacgaa
caggccctggaggccctgcgtttctttgcaaagaccgagggcaccctttttgccctggaa
tccgcccatgccgggtacgcggccatgcaggaggcaaaacgcctcggtccgggaaaggtc
atcgttatcaatatgtcgggacgaggtgataaagaccttttcatcaccgcagcaaacgaa
aaaccgaaagaatgggcggagttcctccgccgtgaagcggaggccttatcatga

DBGET integrated database retrieval system