KEGG   Spirochaeta smaragdinae: Spirs_4124Help
Entry
Spirs_4124        CDS       T01287                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spirs_4124
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_4124
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spirs_4124
Enzymes [BR:ssm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spirs_4124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4456986..4457768
Genome map
AA seq 260 aa AA seqDB search
MKKTNSKDGSHSRPLLMAHLIAGYPDLATSLEIAKALVEGGAQMLELQMPSSDPAADGPA
IQAACTQALDRGLRLDHGFELAKRIVEATKVPLYIMAYACQIYARGIKRFVDDSSKAGAA
GIIAPDLPVGEDEGLYAACAQSGLDCVPVIPITAPQKRVEEIMAAARPARWVYTALRAGI
TGSQTKLTSEAMALLEDIRQRGARTIAGFGISSKGQIELLAGHSDAVVAGTFFVRTIAKA
QLEGEAPTTAVRIAAEKLLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacgaatagcaaggatggcagccatagccgtcctcttttgatggcacatctt
atcgccggctatcccgaccttgccacaagcctcgagatagcaaaagcccttgtcgaaggg
ggtgcccaaatgctcgaactgcagatgccctcctccgatcctgctgccgacgggcctgcc
atccaagcggcctgtacccaggcccttgatcgaggacttcgccttgatcacggttttgaa
cttgccaaacgtattgtcgaggcaaccaaggtacctctttacatcatggcatacgcctgt
cagatatacgcccgaggcatcaagcgatttgtcgatgatagcagtaaagcaggggcggcc
ggaatcatcgcaccggaccttccagtgggagaagatgaaggactttacgcggcctgtgca
cagagcggcttggattgtgtaccggtcatccctattaccgcacctcaaaaacgggtagag
gagattatggccgctgccagacccgcccgctgggtctacacagctctcagagcgggaatt
accggttcgcaaacgaaactcacctctgaggccatggcactactcgaagatattcggcaa
cggggagccaggaccattgcaggttttggtatctcaagtaaaggtcagatagagctgctt
gcaggccacagcgatgcagtggtagcagggaccttctttgttcggacaattgcaaaggct
caattagagggagaagccccgacaactgcagttcggatcgctgcagagaagcttttgagc
taa

DBGET integrated database retrieval system