KEGG   Spirochaeta smaragdinae: Spirs_4124Help
Entry
Spirs_4124        CDS       T01287                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spirs_4124
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_4124
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spirs_4124
Enzymes [BR:ssm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spirs_4124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4456986..4457768
Genome map
AA seq 260 aa AA seqDB search
MKKTNSKDGSHSRPLLMAHLIAGYPDLATSLEIAKALVEGGAQMLELQMPSSDPAADGPA
IQAACTQALDRGLRLDHGFELAKRIVEATKVPLYIMAYACQIYARGIKRFVDDSSKAGAA
GIIAPDLPVGEDEGLYAACAQSGLDCVPVIPITAPQKRVEEIMAAARPARWVYTALRAGI
TGSQTKLTSEAMALLEDIRQRGARTIAGFGISSKGQIELLAGHSDAVVAGTFFVRTIAKA
QLEGEAPTTAVRIAAEKLLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacgaatagcaaggatggcagccatagccgtcctcttttgatggcacatctt
atcgccggctatcccgaccttgccacaagcctcgagatagcaaaagcccttgtcgaaggg
ggtgcccaaatgctcgaactgcagatgccctcctccgatcctgctgccgacgggcctgcc
atccaagcggcctgtacccaggcccttgatcgaggacttcgccttgatcacggttttgaa
cttgccaaacgtattgtcgaggcaaccaaggtacctctttacatcatggcatacgcctgt
cagatatacgcccgaggcatcaagcgatttgtcgatgatagcagtaaagcaggggcggcc
ggaatcatcgcaccggaccttccagtgggagaagatgaaggactttacgcggcctgtgca
cagagcggcttggattgtgtaccggtcatccctattaccgcacctcaaaaacgggtagag
gagattatggccgctgccagacccgcccgctgggtctacacagctctcagagcgggaatt
accggttcgcaaacgaaactcacctctgaggccatggcactactcgaagatattcggcaa
cggggagccaggaccattgcaggttttggtatctcaagtaaaggtcagatagagctgctt
gcaggccacagcgatgcagtggtagcagggaccttctttgttcggacaattgcaaaggct
caattagagggagaagccccgacaactgcagttcggatcgctgcagagaagcttttgagc
taa

DBGET integrated database retrieval system