KEGG   Spirochaeta smaragdinae: Spirs_4144Help
Entry
Spirs_4144        CDS       T01287                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spirs_4144
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Spirs_4144
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spirs_4144
Enzymes [BR:ssm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Spirs_4144
Exosome [BR:ssm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spirs_4144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4482352..4483833
Genome map
AA seq 493 aa AA seqDB search
MTRMKRILALTLSLLVSAALFAGGNAETVNTEAQTDQAETARAKYVFFFIGDGMALPQIN
AAEALLGTKDNQGTPKKLTFSKFPVQGLTTTYAANAFITDSAAAGTALATGHKTNSGVIS
MDPTGSTSYKTLAEMAKEAGMKVGIVSSVNLDHATPAVFYAHKKSRSDYYAINVQMAESN
FDYFGGGMVRIDKTPAGEKSAHDIMKERGFVIASDREQFNAMKPEAEKQYYAYNTGFAAN
ALDYTIDMDSSAITLAEFTQKGIELLDNDKGFFMMVEGGKIDWACHANDAAASIYDTIAF
DQAIQKAVDFYNRHPNETLIVVTGDHETGGLSLGFAGTQYDSAFDEIAKQKKSFEWFDTY
VLKPYKENKPNGSLADLMPKIEETFGLTDLTDYETAQLQEAFTRSMGGEVERPKSQDEYL
LYGGYEPLSVTITHLLNQRAGIAWASYSHTGVPVATFALGASSGQFNGYYDNTDIFTKLS
NAMFAGASVAMAR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggatgaaaaggattcttgcactgaccctctcgcttcttgtttccgccgccctt
tttgccggagggaatgccgagacggtaaacacggaagcacagaccgaccaggcagaaacg
gcccgggcaaagtacgtttttttctttattggagacggtatggcactgcctcagatcaat
gccgccgaagcccttcttggaacgaaagataatcaaggcaccccgaaaaagctcacattt
tcgaaatttcccgtacaaggtttgacaacgacctacgcagccaatgcctttattaccgac
agcgccgcggcagggaccgcccttgcaaccgggcacaaaaccaactcgggtgtcatttcg
atggatcccaccggttcgaccagctacaagaccctcgcagaaatggcgaaagaagcagga
atgaaggtaggaattgtttcaagcgtaaacctcgaccatgcgactcctgcagtgttttat
gcccacaaaaaaagccgcagcgactactacgccatcaatgttcagatggctgagagtaac
ttcgactacttcggcggaggcatggtgcggatagacaagacccctgcaggtgaaaaaagc
gcccacgacatcatgaaggaacggggctttgtcattgcatcggacagggagcagttcaac
gccatgaagccggaagcggaaaaacagtactacgcctataacaccggttttgccgcaaac
gccctggattacaccatcgatatggatagcagcgcgatcacccttgcagagtttacccaa
aagggaatcgaacttttggataacgacaagggattcttcatgatggtggaaggtggaaaa
atcgactgggcatgtcatgccaacgatgccgccgcgtcgatttacgacaccattgccttt
gaccaggcgatacagaaggccgttgatttctacaaccgccatcccaatgaaaccctcatt
gtcgtgaccggtgaccatgaaaccggtgggctctccctcggctttgccggcacacagtac
gatagtgctttcgatgaaatcgcaaaacagaaaaagtctttcgagtggttcgatacctac
gtcctgaaaccctataaagagaacaagcccaatggttctcttgccgatctgatgccgaag
atcgaagaaaccttcggtcttaccgatctgactgattacgaaacggctcagctgcaggaa
gcctttactcgctccatggggggagaggtcgaacggcccaaaagccaggatgagtacctt
ctctacggaggttatgaacccctgtcggttaccatcacccatctgttaaaccagcgggcg
ggaatcgcctgggcaagctacagtcataccggtgttccggttgccacctttgcccttggt
gcttcaagcggtcagttcaacgggtattacgacaataccgatatttttaccaagctctcc
aatgccatgtttgccggtgcttccgtcgccatggcccgataa

DBGET integrated database retrieval system