KEGG   Spirochaeta smaragdinae: Spirs_4176Help
Entry
Spirs_4176        CDS       T01287                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Spirs_4176
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spirs_4176
   00650 Butanoate metabolism
    Spirs_4176
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Spirs_4176
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spirs_4176
   00622 Xylene degradation
    Spirs_4176
   00621 Dioxin degradation
    Spirs_4176
Enzymes [BR:ssm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Spirs_4176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4513026..4513931)
Genome map
AA seq 301 aa AA seqDB search
MKQKIKVAILGTGNIGTDLMFKIRKRSSNMELKLFSGIDKNSSGMKLAREHGVTTSARSI
DAILQEKDIRIVFDATSAGAHLKHAPLLKQAGKIAIDLTPAAVGEFVIPVINLDHLISQD
IHGLNVNMVTCGGQATIPIVYAISRVAKTSYAEIVATLASKSAGPGTRVNIDEFTTTTAN
GIIKLGKAENSKAIILLNPADPPMMMNCTIYAMCKEYSEREVTESVNNMISELQNYIPGY
RLKVPPQFDGERIMVMVQVQGAGDFLPVYAGNLDIMTSAAQTVGDVVAGKLLSEMQLKES
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaaaataaaggtggcaatattgggtacaggcaatattggtacagaccttatg
tttaagatcagaaaacgtagcagcaatatggagctgaaactgttctcgggtatcgataaa
aattccagtggaatgaaacttgccagggagcatggtgtcacaacatcggcaagaagtatt
gatgccattcttcaagaaaaagacatccggattgtgtttgacgcaacaagtgccggtgct
caccttaagcatgctcccctgttaaagcaggcgggaaaaatagcgatagacttgactcct
gctgccgttggagaatttgttataccggttattaatctagatcatctaatttcgcaggac
atccatggcttaaatgtcaacatggtaacttgtggagggcaggcaaccatacccatcgtt
tatgcaatctcaagggttgcaaaaacatcttacgctgaaatcgtggctacattggcaagc
aagagtgcaggtccgggaacgcgtgtcaatattgacgaattcactactactactgcaaac
ggcatcatcaaattagggaaggccgaaaacagcaaggcgattattctcctgaatcccgca
gatccaccgatgatgatgaactgcacaatttatgcaatgtgcaaggaatacagtgaacgg
gaagttactgaatcggtgaataacatgatttccgaattgcagaactatataccgggctat
cgcttaaaagtgccaccacagtttgacggagagagaataatggtcatggtacaggtgcag
ggtgcgggcgatttcctcccggtgtatgcaggcaaccttgacattatgacatcggctgca
cagacggttggagatgtggttgcaggaaaattattgtcggaaatgcaactgaaggaatca
gtgtga

DBGET integrated database retrieval system