KEGG   Spirochaeta smaragdinae: Spirs_4286Help
Entry
Spirs_4286        CDS       T01287                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spirs_4286
   01230 Biosynthesis of amino acids
    Spirs_4286
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spirs_4286
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Spirs_4286
Enzymes [BR:ssm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Spirs_4286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4625276..4627267
Genome map
AA seq 663 aa AA seqDB search
MNLEALRAAATSVRSLSMDAIQTANSGHPGLPMGCAELGALLYGEIMKHYPKNPQWPNRD
RFVLSAGHGSMFLYSLLHLSGYDLPLEELKRFRQIGSKTPGHPEYGYTPGVETTTGPLGA
GLSEAVGMAAAETFLAANFNTADAKVVDHYTWVLAGDGCMMEGISSEASSLAGHLKLGKL
IVFYDSNKISIEGSTSLAFTEDVAERYRAYGWQVLSGDMYDMEKTAALVEEAKAETGKPS
LIILASIIGKGSPNKAGSSKVHGSPLGVDEVIATRKNLGIPENESFYIAPKAKTYFTEKL
EERKASFDAWNTLFDSWSKAHPELRKKWDRWFEGDRKAAAEAALAAAKMPKYKVGDSVAT
RKAGGAALQAAAAAMENLVGGSADLAPSNNTALPDYGDYSAEERAGRTFHFGVREHAMGA
LANGLSLHGGLRSFAATFLVFSDYMRPQVRLSAIMKEPVVYVFTHDSIFVGEDGPTHQPI
EHAAALRIIPNVHVFRPADAEETVRAWELALLRDDGPSALLLTRQNLPVVEKADGSWRDS
MATKGAYIVRESNGAPKLVVVATGSELSMALEAVDLTERTDIRVVSMPCKERFLALSDDE
KAKLLPKGAEVYATEAGVSDGWEAVTGCRDRVFGINRFGESGPGEAVAEDIGFTAKAFAE
MLK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgaagctttacgggcggccgccacatcggtaaggtcgctctcgatggatgcc
attcagacagccaactcgggacatcctggactacccatgggctgcgcggaactgggagca
ctgctctacggcgaaatcatgaaacactacccaaagaatcctcaatggccgaaccgtgac
cgatttgtcttatctgccgggcatggttcgatgtttctctactcgctccttcatctttca
ggatacgaccttcccttagaagagttgaagcgttttcgtcagataggatcaaagacccct
ggacaccccgagtacggctatacccccggagtcgagaccacaaccgggcctctcggcgcc
ggcctttccgaagcggtcgggatggcggcggcggagacctttctggctgccaattttaac
accgccgatgcaaaggtggttgatcactacacctgggtccttgccggagacggttgtatg
atggagggaattagctccgaggccagcagccttgccggacatttgaaacttggcaagctt
atcgtcttctacgattcgaataaaatcagtattgaaggttccacatctctcgcctttacc
gaagatgttgccgaacgctaccgtgcatatggctggcaggtgctttccggcgacatgtac
gatatggaaaaaaccgccgcccttgtagaagaggctaaggcggaaacgggaaagccttcc
ctgattattcttgcctccattattggcaagggcagtcccaacaaggcgggcagttccaaa
gtgcatggttcccctcttggtgtcgatgaggtcattgcaacccgaaaaaatctcggtatc
cctgagaacgaatccttttatatcgctccgaaggcaaaaacgtatttcacggagaaactg
gaagaacgaaaggcctccttcgacgcctggaatacgctctttgattcctggagcaaggct
catcccgagcttcggaaaaagtgggaccgttggttcgaaggcgatagaaaagctgctgcc
gaagcagcccttgccgcggcgaagatgcctaaatataaggttggcgattccgtcgctaca
cgaaaggcaggaggcgccgccctccaggccgctgcagccgccatggaaaatcttgtcggt
gggtccgccgatctcgccccaagcaataacaccgctcttcccgactacggtgattacagt
gccgaggagagggccggcagaacctttcacttcggcgtcagagagcatgccatgggtgcc
ttggcaaacggtctttcactccacgggggtctccgttcctttgccgcaacctttctggtt
ttctccgattacatgcggccccaggtccggctatcggcgatcatgaaggaaccggtcgtc
tatgtctttacacacgattcgatctttgtgggtgaagatggcccgacccatcagcctatc
gaacacgccgcggcgttgcgtatcattcccaacgttcatgtcttccgccctgcggatgcc
gaagagacggtgagggcctgggaacttgcgcttctgagagacgacggcccctcggccctg
ctgctcacccgtcaaaaccttccggttgtggaaaaagcggacggctcatggcgcgattca
atggctacaaaaggtgcttatatcgtacgggaaagcaacggtgctccgaaacttgtggtc
gtggctacaggctccgagctttccatggcccttgaagcggtcgatctaacagagcgcacg
gacatcagggtcgtctccatgccctgcaaggagcgattcctagctctttccgacgacgaa
aaggccaagctgctgccgaaaggagcggaggtctatgccaccgaagcgggagtcagcgac
ggctgggaagctgttaccggctgccgggatagggtcttcggtatcaatcgcttcggagaa
tcgggcccaggtgaagccgttgccgaggatatcggctttaccgcaaaggcctttgcggaa
atgctaaagtag

DBGET integrated database retrieval system