KEGG   Shigella sonnei Ss046: SSON_0197Help
Entry
SSON_0197         CDS       T00274                                 

Gene name
accA
Definition
acetyl-CoA carboxylase carboxyltransferase subunit alpha (EC:6.4.1.2)
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
ssn  Shigella sonnei Ss046
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSON_0197 (accA)
   01212 Fatty acid metabolism
    SSON_0197 (accA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSON_0197 (accA)
   00640 Propanoate metabolism
    SSON_0197 (accA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SSON_0197 (accA)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    SSON_0197 (accA)
Enzymes [BR:ssn01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SSON_0197 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
223542..224501
Genome map
AA seq 319 aa AA seqDB search
MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGA
WQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQK
GRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEA
IARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKS
ADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAVSLKAQLLADLADLDVL
STEDLKNRRYQRLMSYGYA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaatttccttgattttgaacagccgattgcagagctggaagcgaaaatcgat
tctctgactgcggttagccgtcaggatgagaaactggatattaacatcgatgaagaagtg
catcgtctgcgtgaaaaaagcgtagaactgacacgtaaaatcttcgccgatctcggtgca
tggcagattgcgcaactggcacgccatccacagcgtccttataccctggattacgttcgc
ctggcatttgatgaatttgacgaactggctggcgaccgcgcgtatgcagacgataaagct
atcgtcggtggtatcgcccgtcttgacggtcgtccggtgatgatcattggtcatcaaaaa
ggtcgtgaaaccaaagaaaaaattcgccgtaactttggtatgccagcgccagaaggttac
cgcaaagcactgcgtctgatgcaaatggctgaacgctttaagatgcctatcatcaccttt
atcgacaccccgggggcttatcctggcgtgggcgcagaagagcgtggtcagtctgaagcc
attgcacgcaacctgcgtgaaatgtctcgcctcggcgtaccggtagtttgtacggttatc
ggtgaaggtggttctggcggtgcgctggcgattggcgtgggcgataaagtgaatatgctg
caatacagcacctattccgttatctcgccggaaggttgtgcgtccattctgtggaagagc
gccgacaaagcgccgctggcggctgaagcgatgggtatcatcgctccgcgtctgaaagag
ctgaaactgatcgactccatcatcccggaaccgctgggcggcgctcaccgtaacccggaa
gcgatggcggtatcgttgaaagcgcaactgctggcggatctggccgatctcgatgtgtta
agcactgaagatttaaaaaatcgtcgttatcagcgcctgatgagctacggttacgcgtaa

DBGET integrated database retrieval system