KEGG   Shigella sonnei Ss046: SSON_0299Help
Entry
SSON_0299         CDS       T00274                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ssn  Shigella sonnei Ss046
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSON_0299 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SSON_0299 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SSON_0299 (lacZ)
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SSON_0299 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
328041..331115
Genome map
AA seq 1024 aa AA seqDB search
MIMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR
FAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPAENP
TGCYSLTFNIDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRA
GKNRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPSTQISDFHVATHFNDDFSRAV
LEAEVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPA
LWSAEIPNLYRAVVELHTDDGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEH
HPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRFGLYVVDEANIETHG
MVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD
PSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWSVALD
GKPLASGEMPLDVAPQDKQLIELPELPQPESAGQLWLTVHVVQPNATAWSEAGHISAWQQ
WRLAENLSVTLPAAPHAIPQLTTSETDFCIELGNKRWQFNRQSGFLSQMWIGAEKQLLTP
LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTA
HAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLTCQLAQVAERVNWLG
LGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI
SRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGSYHYQLV
WCQK
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgattacggattcactggccgtcgttttacaacgtcgtgactgggaaaaccct
ggcgttacccaacttaatcgccttgcagcacatccccctttcgccagctggcgtaatagc
gaagaggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcgaatggcgc
tttgcctggtttccggcaccagaagcggtgccggaaagctggctggagtgcgatcttcct
gaggccgatactgtcgtcgtcccctcaaactggcagatgcacggttacgatgcgcccatc
tacaccaacgtgacctatcccattacggtcaatccgccttttgttcccgcggagaatccg
acgggttgttactcgctcacatttaatattgatgaaagctggctacaggaaggccagacg
cgaattatttttgatggtgttaactcggcgtttcatctgtggtgcaacgggcgctgggtc
ggttacggccaggacagccgtttgccgtctgaatttgacctgagcgcatttttacgcgcc
ggaaaaaaccgcctcgcggtgatggtgctgcgctggagtgacggtagttatctggaagat
caggatatgtggcgaatgagcggcattttccgtgacgtctcgttgctgcacaaaccgagc
acacaaatcagcgatttccatgttgccactcactttaatgatgatttcagccgcgcggta
ctggaggcagaagttcagatgtacggcgagctgcgcgatgagctgcgggtgacggtttct
ttgtggcagggtgaaacgcaggtcgccagcggcaccgcgcctttcggcggtgaaattatc
gatgagcgtggtggttatgccgatcgcgtcacgctacgtctgaacgtcgaaaacccggcg
ctgtggagcgccgaaatcccgaatctctatcgtgcggtggttgaactgcacaccgacgac
ggcacgctgattgaagcagaagcctgcgatgtcggtttccgcgaggtgcggattgaaaat
ggtctgctgctgctgaacggcaagccgttgctgattcgcggcgttaaccgtcacgagcat
catcctctgcatggtcaggtcatggatgagcagacgatggtgcaggatatcctgctgatg
aagcagaacaactttaacgccgtgcgttgttcgcattatccgaaccatccgctgtggtac
acgctgtgcgaccgcttcggcttgtacgtggtggatgaagccaatattgaaacccacggc
atggtgccaatgaatcgtctgaccgatgatccgcgctggttacccgcgatgagcgaacgc
gtaacgcgaatggtgcagcgcgatcgtaatcacccgagtgtgatcatctggtcgctgggg
aatgagtcaggccacggcgctaatcacgacgcactctatcgctggatcaaatctgtcgat
ccatcccgcccggtgcagtatgaaggcggcggagccgacaccacggccaccgatattatt
tgcccgatgtacgcgcgcgtggatgaagaccagcccttcccggctgtgccgaaatggtcc
atcaaaaaatggctttcgctacctggagagacgcgcccgctgatcctttgcgaatacgcc
cacgcgatgggtaacagtcttggcggcttcgctaaatactggcaggcgtttcgtcagtac
ccccgtttacagggcggcttcgtctgggactgggtggatcagtcgctgattaaatatgat
gaaaatggcaatccgtggtcggcttacggcggtgattttggcgatacaccgaacgatcgc
cagttctgcatgaacggtctggtctttgccgaccgcacgccgcatccagcgctgacagaa
gcaaaacaccagcagcagtttttccagttccgtttatccgggcaaaccatcgaagtgacc
agcgaatacctgttccgtcatagcgataacgagcttctgcactggtcggtggcgttggat
ggcaagccgctggcaagcggtgaaatgcctctggatgttgctccacaagataaacagttg
attgaactgcctgaactaccgcagccggagagcgccggacaactctggcttacggtacac
gtagtgcaaccgaacgcgaccgcatggtcagaagccggacacatcagcgcctggcagcag
tggcgtctggcggaaaacctcagcgtgacactccccgccgcgccccacgccatcccgcaa
ctgaccaccagcgaaacggatttttgcatcgagctgggtaataaacgttggcaatttaac
cgccagtcaggctttctttcacagatgtggattggcgctgaaaaacaactgctgacgccg
ctgcgcgatcagttcacccgtgcaccgctggataacgacattggcgtaagtgaagcgacc
cgcattgacccgaacgcctgggtcgaacgctggaaggcggcgggccattaccaggccgaa
gcagcgttgttgcagtgcacggcagatacacttgccgacgcggtgctgattacgaccgct
cacgcgtggcagcatcagggaaaaaccttatttatcagccggaaaacctaccggattgat
ggtagtggtcaaatggcgattaccgttgatgttgaagtagcgagcgatacaccgcatccg
gctcggattggcctgacctgccagctggcgcaggtagcagaacgggtaaactggctcgga
ttagggccgcaagaaaactatcccgaccgccttactgccgcctgttttgaccgctgggat
ctgccattgtcagacatgtataccccgtacgtcttcccgagcgaaaacggtctgcgctgc
gggacgcgcgaattgaattatggcccacaccagtggcgcggcgacttccagttcaatatc
agtcgctacagccaacaacaactgatggaaaccagccatcgccatctgctgcacgcggaa
gaaggcacatggctgaatatcgacggtttccatatggggattggtggcgacgactcctgg
agcccgtcagtttcagcggaattccagcttagcgccggtagctaccattaccagttggtc
tggtgtcaaaaataa

DBGET integrated database retrieval system