KEGG   Shigella sonnei Ss046: SSON_0358Help
Entry
SSON_0358         CDS       T00274                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ssn  Shigella sonnei Ss046
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssn00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ssn00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ssn02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
384483..385967
Genome map
AA seq 494 aa AA seqDB search
MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGD
ITAPGGARRLTSDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGI
DALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEM
AKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQL
LNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVNDAASLNSVTEANQQKPL
LGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKTIELLSKNEK
GFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQ
VVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQ
TDLFYTMKAALGLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacggccgagacttatagtcgctttgtttttattttttaatgtatttgtacatgga
gaaaataaagtgaaacaaagcactattgcactggcactcttaccgttactgtttacccct
gtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgat
attactgcacccggcggtgctcgccgcttaacgagtgatcagaccgccgctctgcgtgat
tctcttagcgataaacctgcaaaaaatattattttgctgattggcgatgggatgggggat
tcggaaattactgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatc
gatgccttaccgcttaccgggcaatacactcactatgcgctgaataaaaaaactggcaaa
ccggactacgtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacc
tataacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatg
gcaaaagccgcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacg
cccgctgcgctggtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagt
gaaaaatgtccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctg
cttaacgctcgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggca
accgctggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcag
ttggtgaacgatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctg
cttggcctgtttgctgacggcaatatgccagtgcgctggctagggccgaaagcaacgtac
cacggcaatatcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagt
gtaccaaccctggcacagatgaccgacaaaaccattgaattgttgagtaaaaatgagaaa
ggatttttcctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatcct
tgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattc
gctaaaaaggagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccag
gttgttgcgccggataccaaagcgccgggcctcactcaggcgctaaatactaaagatggc
gcagtgatggtgatgagttacgggaattccgaagaggattcacaagaacataccggcagt
cagttgcgtattgcggcgtatggtccgcatgccgccaatgttgttggactgaccgaccag
accgatctcttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system