KEGG   Shigella sonnei Ss046: SSON_0733Help
Entry
SSON_0733         CDS       T00274                                 

Definition
lysozyme-like protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ssn  Shigella sonnei Ss046
Brite
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SSON_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
774476..774973
Genome map
AA seq 165 aa AA seqDB search
MSPSLRKAVAVAIGGGAVAIASVLITGPGGNDGLEGVSYILYKDIIGVWTVCHGHTGKDI
MPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGYIKGACDQLCRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcattacgcaaggctgttgcagttgctattggtggcggggctgttgctata
gcatctgtgttaatcactggcccaggtggtaacgatggtctggaaggtgtcagctacata
ctatacaaagatatcattggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgcctggtaaaacgtataccgaagcagaatgcaaagctctcctgaataaagaccttgcc
actgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtttacaacgtgggcgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggctatatcaaaggcgcatgtgaccagctatgtcgctggacatat
gctggcggtaagcaatggaaagggctgatgacccgtcgtgagattgagcgtgaagtctgt
ttgtgggggcagcaatga

DBGET integrated database retrieval system