KEGG   Shigella sonnei Ss046: SSON_1476Help
Entry
SSON_1476         CDS       T00274                                 

Definition
bifunctional cysteine desulfurase/selenocysteine lyase (EC:4.4.1.16)
Orthology
K11717  
cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
ssn  Shigella sonnei Ss046
Pathway
Selenocompound metabolism
Thiamine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:ssn00450]
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:ssn00730]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
1551449..1552669
Genome map
AA seq 406 aa AA seqDB search
MTFSVDKVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHT
LSAQATEKMENVRKRASLFINARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQ
MEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDEKTRLLAITHVSNVLGTE
NPLAEIITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKE
ALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLN
NIAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVIAFNLGKHHAYDVGSFLDNYGIAVRT
GHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHRLLG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgactttttccgtcgacaaagtgcgggccgactttccggtgctttctcgtgaggtgaac
ggtttgccgctggcttatctcgacagcgccgccagtgcgcagaaaccaagccaggtgatt
gacgccgaggctgagttttatcgtcacggctacgcggcggtgcatcgcggtattcatacc
ttaagcgcccaggcgaccgagaaaatggagaacgtgcgcaagcgggcatcgctgtttatt
aatgcccgttcggcggaagagctggtgttcgtccgcggcacgacggaagggatcaatctg
gtcgccaatagttggggcaacagcaacgtgcgggcgggcgataacatcatcatcagtcag
atggagcaccacgctaacattgttccctggcagatgctttgcgcacgcgttggcgcagag
ctgcgtgtgatccctctcaaccccgacggtacgctgcaactggagacgctgcctacgctg
tttgatgagaaaactcgcctgctggcaattactcatgtctccaacgtgctgggaacagaa
aatccgctggcggaaataatcacgcttgcgcaccagcatggcgcaaaagtgctggtggat
ggcgctcaggcggtgatgcatcatccggtggatgttcaggcgctggattgcgacttttac
gtgttctccgggcataaactgtatggccccaccggaattggcattctttatgtgaaagaa
gccttgttgcaggagatgccgccgtgggaagggggcggttctatgatcgccaccgtcagc
ctgagtgaaggcactacctggaccaaagcaccatggcggtttgaagccggtacacccaat
accgggggcattattggtcttggcgcggcgctggagtatgtttcggcgctggggcttaat
aacatagccgagtatgaacagaatctgatgcattatgcgctatcacagctggaatctgta
ccggatctcactctctatggcccacaaaacaggcttggcgttattgcttttaatctcggt
aaacaccacgcctatgatgttggcagttttctcgataattacggcattgctgtgcgtacc
ggacatcactgcgctatgccattaatggcctattacaacgtccctgcgatgtgtcgggcg
tcgctggccatgtataacacccatgaagaagtggatcgtctggtgaccggcctgcaacgt
attcaccgtttgctgggataa

DBGET integrated database retrieval system