KEGG   Shigella sonnei Ss046: SSON_1634Help
Entry
SSON_1634         CDS       T00274                                 

Definition
hypothetical protein
Orthology
K13069  
diguanylate cyclase [EC:2.7.7.65]
Organism
ssn  Shigella sonnei Ss046
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
1723836..1725218
Genome map
AA seq 460 aa AA seqDB search
MEMYFKRMKDEWTGLVEQADPLIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQ
VERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILY
PVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSASKEDENYRIFSLLENAEE
EKERQIASILSWEIDIIYKILLDSDLGSSLPLSQADFGLWFNHKGRHYFSGIAEVGHISR
LIQDFDGIFNQTMRNTRNLNNRSLRVKFLLQIRNTVSQIITLLRELFEEVSRHEVGMDVL
TKLLNRRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAF
YDNVHSSDYVFRYGGDEFIIVLTEASENETLRTAERIRSRVEKTKLKAANGEDIALSLSI
GAAMFNGHPDYERLIQIADEALYIAKRRGRNRVELWKASL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggagatgtattttaaaagaatgaaagatgagtggaccggacttgtcgaacaggcagat
ccactcattcgtgctaaagccgcggaaattgccgttgcgcatgctcattatctgagtatc
gagttttatcgaattgtccgcatcgacccgcatgccgaagaattcttgagtaatgaacaa
gttgagcggcagttgaaaagtgcgatggaacgctggattattaacgtgctttctgcccag
gttgacgatgtcgaaaggctaatacaaatccagcataccgtcgcggaagtgcatgcccgc
ataggaattccggtagaaattgtcgagatggggtttcgggtgctgaaaaaaatcctctat
ccggtaatcttctcttcggattattccgccgcagaaaaacttcaggtctatcatttctcg
attaacagtattgatatcgcgatggaagtgatgacccgcgcgtttacctttagtgacagt
agtgcctcaaaggaagatgaaaattatcgtatcttctcgttactggaaaacgccgaagaa
gaaaaagaacggcaaatagcctcaatactttcatgggaaatagatattatctataaaatc
ctgctggattctgatttaggcagtagtttgccattaagccaggctgattttggcctgtgg
tttaaccataaaggtcgacattattttagtggcattgccgaagtaggccatatctcccgt
ctcattcaggatttcgacggtattttcaatcaaaccatgcgtaacaccaggaatttgaat
aacagaagtctgcgggtgaaatttttattacagataagaaataccgtatcgcagattatt
accttgctgcgtgaattgtttgaagaagtatcgcgccacgaagtcggtatggatgtacta
acgaaattacttaaccgccgtttcctgccgactatcttcaaacgcgaaattgcccatgcc
aaccggaccggtacaccgctgtcagtgctgattattgacgttgataaattcaaagagatc
aacgatacgtggggccataacactggcgatgaaattctgcgtaaagtctctcaggccttt
tatgacaacgtccacagtagtgattatgtttttcgctacgggggcgatgaatttatcatt
gttttgactgaagcttctgaaaacgaaacgttacgtaccgcagaacgtattcgcagtcgg
gtggagaaaaccaaactgaaagccgcaaacggcgaggatattgccctctcactttccatc
ggtgccgccatgtttaatggtcatcctgactatgagcgcctcattcaaatagccgatgaa
gctctgtatatcgccaaaagacgaggtagaaaccgtgttgaactctggaaagccagtctt
tag

DBGET integrated database retrieval system