KEGG   Shigella sonnei Ss046: SSON_1881Help
Entry
SSON_1881         CDS       T00274                                 

Gene name
trpC
Definition
(GenBank) N-(5-phosphoribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01130  Biosynthesis of antibiotics
ssn01230  Biosynthesis of amino acids
Module
ssn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSON_1881 (trpC)
Enzymes [BR:ssn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SSON_1881 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SSON_1881 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAZ88552
ShiBASE_China: SSO1881
UniProt: Q3Z110
Position
1979742..1981103
Genome map
AA seq 453 aa AA seqDB search
MMQTVLAKIVADKAIWVETRKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASP
SKGVIRDDFDPARIASIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIID
PYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAK
VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSAL
MAHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLILVATSPRCVNVEQAQEV
MAAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQLYIDTLREALPAHVAIWKAL
SVGETLPARELQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQT
GCAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgc
aaacagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttt
tatgatgcgctacagggtgcacgcacggcgtttattctggagtgcaagaaagcgtcgccg
tcaaaaggcgtgatccgtgatgatttcgatccggcacgcattgcctccatttataaacat
tacgcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttc
ctccccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgac
ccttaccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttca
gtactggatgacgaccaatatcgccagcttgcagccgtcgctcacagtctggagatgggg
gtgctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattgggggcaaag
gtcgttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgc
gagcttgcgccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatact
tacgctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttg
atggcccatgacgatttgcacgccgccgtgcgccgggtgttgctgggtgagaataaagta
tgtggtctgacgcgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggt
gggttgattttggttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtg
atggctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtg
gtggacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagatcag
ctgtatatcgatacgctgcgtgaagctctgccagcacacgttgccatctggaaagcatta
agcgtcggtgaaaccctgcccgcccgcgagcttcagcacgttgataaatatgttttagac
aacggccagggtggaagcgggcaacgtttcgactggtcactattaaatggtcaatcgctt
ggcaacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaacc
ggctgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgca
cgtcttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system