KEGG   Shigella sonnei Ss046: SSON_1883Help
Entry
SSON_1883         CDS       T00274                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00260  Glycine, serine and threonine metabolism
ssn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01130  Biosynthesis of antibiotics
ssn01230  Biosynthesis of amino acids
Module
ssn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSON_1883 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSON_1883 (trpA)
Enzymes [BR:ssn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSON_1883 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE
Motif
Other DBs
NCBI-ProteinID: AAZ88554
ShiBASE_China: SSO1883
UniProt: Q3Z108
Position
1982308..1983114
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPIEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISTPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKVFVQPMKVATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggggatccgggcattgagcagtcattgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggcatccccttctccgacccactggcagat
ggcccgacgattcaaaacgccactctgcgcgcctttgcggcaggtgtgactccggcacaa
tgttttgaaatgctggcactgattcgccagaaacacccgaccattcccattggcctgttg
atgtatgccaatctggtgtttaacaaaggcattgatgagttttatgcccagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgccaattgaagagtccgcgcccttccgc
caggccgcgttgcgccataatgtcgcacctatcttcatctgcccgccaaatgccgatgac
gacctgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcacgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcacctccattgcaggggtttggtatttccaccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcagccattgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagtttttgtacaa
ccgatgaaagtggcgacgcgcagttaa

DBGET integrated database retrieval system