KEGG   Shigella sonnei Ss046: SSON_2091Help
Entry
SSON_2091         CDS       T00274                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ssn  Shigella sonnei Ss046
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssn01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ssn00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
2183719..2185023
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKARGDDALREYSAKFDK
TTVNALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVKD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMAHQVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARDLVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcactgttaacgatattctc
gataacgtgaaagcacgcggtgatgacgccctgcgggaatacagcgcgaagtttgataaa
accacggttaacgcgctgaaggtgtctgctgaggagattgccgccgctagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaaaaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgcccggtcgcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcgactccggcgcgtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggtgtgaaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcgaaacgtcag
gtgagccagcgtctggacggtgcggctatcgatatgcccgcaggcccgtcggaagtgttg
gtcattgccgacagcggcgcaacgccggatttcgtggcttctgatttgctttctcaggct
gaacacggcccggactcacaggtgattttactgacgcctgacgctgatatggcgcatcaa
gttgccgaagccgtcgaacgccagttagcagaactgccgcgtgccgaaaccgcccgccag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtagagatctcc
aaccagtacggcccggagcacctgatcatccagacccgcaacgcccgcgatctggtcgat
ggcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggtgat
tacgcctccggcaccaaccacgttctgccgacttacggttacaccgccacctgttccagc
ctcgggctggcagatttccagaagcgtatgaccgtgcaggaactgtcgaaagaaggtttc
tccgcgctggcttcgaccattgaaacattggccgccgccgagcgcctgaccgcccataaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system