KEGG   Shigella sonnei Ss046: SSON_2283Help
Entry
SSON_2283         CDS       T00274                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssn  Shigella sonnei Ss046
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSON_2283 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SSON_2283 (atoB)
   00640 Propanoate metabolism
    SSON_2283 (atoB)
   00650 Butanoate metabolism
    SSON_2283 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    SSON_2283 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SSON_2283 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSON_2283 (atoB)
   00310 Lysine degradation
    SSON_2283 (atoB)
   00380 Tryptophan metabolism
    SSON_2283 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSON_2283 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSON_2283 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SSON_2283 (atoB)
Enzymes [BR:ssn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSON_2283 (atoB)
Exosome [BR:ssn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSON_2283 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
ShiBASE_China: 
UniProt: 
Position
2401082..2402266
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGSLASTSAIDLGATVIKAAIERAKIDSLHIDEVIMGNVLQAG
LGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAIQAGQAKSIVAGGMENMSL
APYLLDAKARSGYRLGDGQVYDVILRDGLMCATHGYHMGITAENVAKEYGITREMQDELA
LHSQRKAAAAIESGAFTAEIVPVNVVTRKKTFVFSQDEFPKANSTAEALGALRPAFDKAG
TVTAGNASGINDGAAALVIMEESAALAAGLTPLARIKSYASGGVPPALMGMGPVPATQKA
LQLAGLQLADIDLIEANEAFAAQFLAVGKTLGFDSEKVNVNGGAIALGHPIGASGARILV
TLLHAMQARDKTLGLATLCIGGGQGIAMVIERLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagtgcggtacgtactgctatcggtagttttaacggttca
ctcgcttccaccagcgccatcgacctgggggcgacagtaattaaagccgccattgaacgt
gcaaaaatcgattcactacacattgatgaagtgattatgggtaacgtgttgcaagccggg
ttggggcaaaatccggcacgtcaggcactgttaaaaagcgggctggcagaaacggtgtgc
ggattcacggtcaataaagtgtgtggttcgggtcttaaaagtgtggcgcttgccgcccag
gcaattcaggcaggtcaggcgaagagcattgtggcggggggtatggaaaatatgagttta
gcgccctacttactcgatgcaaaagcacgctctggttatcgtcttggagacggacaggtt
tatgacgtaatcctgcgcgatggcctgatgtgcgccacccatggttatcatatggggatt
accgccgaaaacgtggctaaagagtacggaattacccgtgaaatgcaggatgaactggcg
ctacattcacagcgtaaagcggcagccgcaattgagtccggtgcttttacagccgaaatc
gtcccggtaaatgttgtcactcggaagaaaaccttcgtcttcagtcaagacgaattcccg
aaagcgaattcaacggctgaagcgttaggtgcattgcgcccggccttcgataaagcagga
acagtcaccgctgggaacgcgtctggtattaacgacggtgctgccgctctggtgattatg
gaagaatctgcggcgctggcagcaggccttacccccctggctcgcattaaaagttatgcc
agcggtggcgtgcctcccgcattgatgggtatggggccagtacctgccacgcaaaaagcg
ttacaactggcggggctgcaactggcagacattgatctcatcgaagctaatgaagcattt
gctgcacagttcctcgccgttgggaaaaccctgggctttgattctgagaaagtgaatgtc
aacggcggggccatcgcgctcgggcatcctatcggtgccagtggtgctcgtattctggtc
acactattacatgccatgcaggcacgcgataaaacgctggggctggcaacactgtgcatt
ggtggcggccagggaattgcgatggtgattgaacggttgaattaa

DBGET integrated database retrieval system