KEGG   Shigella sonnei Ss046: SSON_2437Help
Entry
SSON_2437         CDS       T00274                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ssn  Shigella sonnei Ss046
Brite
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SSON_2437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(2572244..2572741)
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPGGNDGLEGVRHNPYKDIVGVWTVCYGHTGKDI
IPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRCALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGNQWKGLMTRREIEREVCLWGKQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagctgttgctgctgctattggtggcggggctattgctata
gcatctgtgttaatcactggcccaggtggtaacgatggtctggaaggtgtgagacataat
ccttacaaagacatagttggtgtatggactgtatgttacgggcatacaggaaaagacatc
attcccggtaaaacgtataccgaagcagagtgcaaagccctcctgaataaagaccttgcc
actgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgctgc
gctctttactcgttcgtctacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggtgatattaaaggcgcatgtgatcagctacggcgctggacatac
gctggcggtaatcaatggaaaggactgatgactcgccgtgagattgagcgtgaagtctgt
ttgtgggggaaacaatga

DBGET integrated database retrieval system