KEGG   Shigella sonnei Ss046: SSON_2552Help
Entry
SSON_2552         CDS       T00274                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00300  Lysine biosynthesis
ssn01100  Metabolic pathways
ssn01120  Microbial metabolism in diverse environments
ssn01230  Biosynthesis of amino acids
Module
ssn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSON_2552 (dapE)
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SSON_2552 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AAZ89181
ShiBASE_China: SSO2552
UniProt: Q3YZ81
Position
2693675..2694802
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALLIDRLQAIGFTVERMDFADTQNFWAWRGQGET
LAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacaacagcttattcgccgcccttccctgagtcct
gatgacgcaggatgccaggctttgttgattgatcgtttgcaggcgatcggttttaccgtt
gaacgcatggactttgccgatacgcagaatttttgggcatggcgtgggcaaggtgaaaca
ttggcctttgccgggcataccgacgtggtgccgcctggcgacgccgatcgttggatcaat
ccgccgtttgaacccaccattcgtgatggcatgttattcgggcgcggtgcggcagatatg
aaaggctcgctggcggcgatggtggtagcagcagaacgttttgtcgcacaacatcccaac
catacgggacgactggcatttctgatcacctctgatgaagaagccagtgcccacaacggt
acggtaaaagtcgtcgaagcgttaatggcgcgtaatgagcgtctcgattactgtctggtc
ggcgaaccgtcgagtatcgaagtggttggtgatgtggtgaaaaatggtcgtcgcggatcg
ttaacctgcaaccttaccattcatggcgtgcaggggcatgtggcctacccacatctggct
gacaatccagtacatcgcgcagcacctttccttaatgaattagtggctattgagtgggat
cagggcaatgaattcttcccggcgaccagtatgcagattgccaatattcaggcgggaacg
ggcagtaacaacgttattccgggtgaactgtttgtgcagtttaacttccgcttcagcacc
gaactgactgatgagatgatcaaagcgcaggtgcttgccctgcttgaaaaacatcaactg
cgctatacggtggattggtggctttccgggcagccatttttgaccgcgcgcggtaaactg
gtggatgcggtcgttaacgcggttgagcactataatgaaattaaaccgcagctactgacc
acaggcggaacgtccgacgggcgctttattgctcgcatgggggcgcaggtggtggaactc
gggccggtcaatgccactattcataaaattaatgaatgtgtgaacgctgccgacctgcag
ctacttgcccgtatgtatcaacgtatcatggaacagctcgtcgcctga

DBGET integrated database retrieval system