KEGG   Shigella sonnei Ss046: SSON_2783Help
Entry
SSON_2783         CDS       T00274                                 

Gene name
ybcS
Definition
lysozyme-like protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ssn  Shigella sonnei Ss046
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(2933625..2934122)
Genome map
AA seq 165 aa AA seqDB search
MSPSLRKAVAAAIGGGAVAIASVLITGPGGNDGLEGVSYIPYKDIIGVWTVCHGHTGKDI
MLGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcattacgcaaggctgttgcagctgctattggtggtggggctgttgctata
gcatctgtgttaatcactggcccaggtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatatcattggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgctcggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgcc
actgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtttacaacgtgggcgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgaccagctacgtcgctggacatat
gctggcggtaagcaatggaaagggctgatgacccgtcgtgagattgagcgtgaagtctgt
ttgtgggggcagcaatga

DBGET integrated database retrieval system