KEGG   Shigella sonnei Ss046: SSON_2860Help
Entry
SSON_2860         CDS       T00274                                 

Gene name
ascB
Definition
(GenBank) 6-phospho-beta-glucosidase, cryptic
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00010  Glycolysis / Gluconeogenesis
ssn00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSON_2860 (ascB)
   00500 Starch and sucrose metabolism
    SSON_2860 (ascB)
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSON_2860 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AAZ89464
ShiBASE_China: SSO2860
UniProt: Q3YYE8
Position
3002227..3003651
Genome map
AA seq 474 aa AA seqDB search
MSVFPEGFLWGGALAANQSEGAFREGGKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDEITPNQQGIAFYRSVFEE
CKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGTYPAYSARVFREKGVTIDKAPGDDEILK
NTVDFVSFSYYASRCASAEMNANNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDELAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVYVDRDDAGNGTLTRTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccagaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgttccgtgaaggtggcaaagggctgaccactgtcgatatgatcccacacggcgag
catcgaatggcggtgaaactggggctggaaaaacgttttcagttgcgcgatgacgagttt
tatcccagccatgaggcgacggatttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaggttttccgtacctcaattgcctggagccgtctctttccgcag
ggcgatgaaatcacgcccaatcagcagggcattgctttttatcgttctgtctttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacgttgtgccacttcgatgtgccgatgcat
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gcccggacctgctttgaagcatttgatggtctggtgaaatactggcttaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcgggtctggtgtttgaagaaggtgaa
aatcaggatcaggtgaaatatcaggccgcgcatcaccagctggttgccagtgcgctagcc
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggctgtatgctggcgggcggt
aacttctacccttacagttgcaagccggaagatgtctgggcggcgctggagaaagaccgg
gaaaacctgttttttatcgatgtgcaggcgcggggcacgtatccggcttactctgcccgc
gtattccgcgaaaaaggggtaaccatcgacaaagcaccgggcgatgatgaaatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacgccaacaatagcagtgcggcgaacgtagtgaaatcgctgcgtaacccgtatctgcaa
gtgagcgactggggctggggtattgatccactcggtctgcgtatcaccatgaacatgatg
tacgaccgttatcagaagccgctgtttctggtggaaaacggcctcggcgcaaaagatgaa
cttgctgccaatggcgagattaacgatgactatcgcatcagctatttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagatggcattccgctgatgggctacaccacctggggc
tgtattgatttagtctccgcctctacgggtgaaatgagcaaacgctacggttttgtctac
gtagaccgtgacgacgcaggcaacggcacgctgacgcgcacacgtaagaaatcgttctgg
tggtataaaaaagtgattgccagtaatggggaagatttagagtag

DBGET integrated database retrieval system