KEGG   Shigella sonnei Ss046: SSON_2976Help
Entry
SSON_2976         CDS       T00274                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssn  Shigella sonnei Ss046
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSON_2976 (recD)
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SSON_2976 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(3120250..3122076)
Genome map
AA seq 608 aa AA seqDB search
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLEN
NEASHPLLATCVSEIGELQNWEESLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVA
RFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQ
LASVEAGAVLGDICAYANAGFTAERAGQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSYR
FGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQSGEDYIAMLEEALAGYGRYLD
LLQARAEPDLIIQAFNEYQLLCALREGPFGVAGLNERIEQFMQQKRKIHRHSHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHK
SQGSEFDHAALILPSQRTPIVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL
AALFSSRG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaaaagcaattactggaagctgtggagcacaaacagctacgcccgctggat
gtgcaatttgccctgaccgtggcgggagatgaacatcctgccgtcaccctcgcggcggca
ctgttaagtcatgatgccggagagggacacgtctgtttgccgctttcacgactggaaaat
aacgaggcgtcgcatccgctgttggcgacctgtgtcagtgaaatcggtgagctacaaaat
tgggaagaatccttgctggcttctcaagcggtcagcaggggagatgaacccacgccgatg
atcctctgtggcgatcgtctttatttgaatcgcatgtggtgtaacgagcggacggtagcg
cgcttcttcaatgaggtgaatcatgccattgaggttgatgaagctctactggcgcaaacc
ctggacaaactttttccagtaagcgatgaaattaactggcaaaaagtggcggcagcagtg
gcgctgacgcggcggatctcggtgatttccggcggcccaggcaccggtaaaacgaccacc
gtggcgaagttgctggcagcgttaattcaaatggccgacggcgaacgctgccgtatccgt
ctggctgcaccaacgggtaaagctgccgcgcgcttaaccgaatctctcggcaaggctttg
cgacagttaccgctgaccgatgaacaaaagaaacgcattccggaagatgccagcactttg
caccgattgctgggcgcgcagccgggtagccagcgtttacgtcatcatgccggtaacccg
ctgcatcttgatgtgctggtggtagatgaagcgtcaatgatcgatctgcctatgatgtcg
agactgatcgacgccttgcccgatcatgcgcgagtgatctttctcggcgatcgtgatcaa
ctggcctcggttgaggctggggctgtgctgggcgatatctgcgcttatgccaatgccggc
tttaccgccgagcgtgccgggcagctaagccgcctgacgggaactcacgttccggcagga
accggcacagaagcggcatctttgcgcgacagtctctgcctgctgcaaaaaagctatcgt
ttcggcagcgattctggcattggtcagttagctgcggcgatcaaccgtggtgataaaacg
gcagtgaaaaccgtttttcagcaggattttactgatattgaaaaacggcttttacagagc
ggcgaagattatattgcgatgcttgaggaagctcttgcgggttatggacgttatctggat
ctgctgcaagcgcgtgccgagccggatttaatcattcaggcgttcaatgagtaccaactt
ttgtgcgccctgcgggaagggccatttggcgtggctggactgaatgagcgaattgagcag
tttatgcaacagaagcgcaaaattcatcgtcattcgcactctcgttggtacgaaggtcga
ccggtgatgattgcccgtaatgacagcgcgcttgggttgtttaatggcgatatcggtatt
gcgctggatcgcgggcaggggacgcgcgtctggtttgcgatgccggacggcaatattaag
tctgtgcaaccgagtcgcttgccagagcacgaaactacgtgggcgatgacggtacataaa
tcgcagggatcggagttcgaccatgcggcgttgattttaccgagccaacgcacgccgata
gtaacgcgagagctggtatacaccgcggtgacccgcgcgcgtcgccgtctgtcgctgtat
gccgatgagcgtatattaagtgcggcaatcgccactcgtactgagcggcgcagtggtctg
gcggcgttgtttagttcgcggggataa

DBGET integrated database retrieval system