KEGG   Shigella sonnei Ss046: SSON_3310Help
Entry
SSON_3310         CDS       T00274                                 

Gene name
pnp
Definition
(GenBank) polynucleotide phosphorylase
  KO
K00962  
polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
ssn  Shigella sonnei Ss046
Pathway
Purine metabolism
Pyrimidine metabolism
RNA degradation
Module
RNA degradosome
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SSON_3310 (pnp)
   00240 Pyrimidine metabolism
    SSON_3310 (pnp)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SSON_3310 (pnp)
Enzymes [BR:ssn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     SSON_3310 (pnp)
Messenger RNA biogenesis [BR:ssn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SSON_3310 (pnp)
Transfer RNA biogenesis [BR:ssn03016]
 Prokaryotic Type
  tRNA degradation factors
   SSON_3310 (pnp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
ShiBASE_China: 
UniProt: 
Position
complement(3485971..3488175)
Genome map
AA seq 734 aa AA seqDB search
MRRRSGINTSAVRYCLRKRKDITLLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDD
TAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDR
PIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYI
NDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQ
NINELVKEAGKPRWDWQPEPVNEALNARVAALAEARLSDAYRITDKQERYAQVDVIKSET
IATLLAEDETLDENELGEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRT
HGSALFTRGETQALVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPK
RREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPI
KAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKE
IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIR
ALTEETGTTIEIEDDGTVKIAATDGEKAKHAIRRIEEITAEIEVGRVYTGKVTRIVDFGA
FVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQ
PAAAPEAPAAEQGE
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaagatcgggtattaacaccagtgccgtaaggtactgtctaagaaagagaaag
gatattacattgcttaatccgatcgttcgtaaattccagtacggccaacacaccgtgact
ctggaaaccggcatgatggctcgtcaggctactgccgctgttatggttagcatggatgac
accgcggtattcgttaccgttgttggacagaaaaaagccaaaccaggtcaggacttcttc
ccactgaccgttaactatcaggagcgtacctacgctgctggtcgtatcccgggtagcttc
ttccgtcgtgaaggtcgtccaagcgaaggcgaaaccctgatcgcgcgtctgattgaccgc
ccgattcgcccgctgttcccggaaggcttcgtcaacgaagttcaggttatcgccaccgtg
gtttctgttaacccgcaggttaacccggatatcgtcgcgatgattggtgcttccgcagca
ctgtctctgtctggtattccgttcaatggcccgattggtgctgcccgcgtaggttacatc
aatgaccagtacgtactgaacccgactcaggacgagctgaaagagagcaaactggatctg
gttgttgccggtactgaagccgctgtactgatggttgaatctgaagctgaactgctgagc
gaagatcagatgctgggcgcagtagtgttcggtcatgaacaacagcaggttgttattcag
aacatcaatgaactagtgaaagaagccggtaaaccgcgttgggactggcagccggagccg
gtaaacgaagcgctgaacgcgcgcgttgctgcactggctgaagctcgtctgagtgatgct
taccgcatcaccgacaaacaagagcgttatgcgcaggttgatgtcatcaaatctgaaacc
atcgcgacgctgcttgctgaagacgaaaccctggacgaaaacgaactgggtgaaattctg
cacgctatcgagaaaaacgttgttcgtagccgcgtactggcaggcgaaccgcgtatcgac
ggtcgtgaaaaagatatgatccgtggtctggatgtgcgtactggcgtgctgccgcgtact
cacggttctgcgctgttcacccgcggtgaaacgcaggcactggttactgcaacgctgggt
accgctcgtgacgcgcaggttcttgatgaactgatgggcgaacgtaccgataccttcctg
ttccactacaacttccctccgtactccgtaggcgaaaccggcatggtcggttctccgaag
cgtcgtgaaattggtcacggtcgtctggcgaagcgcggcgtgctggcagtcatgccggat
atggacaaattcccgtacaccgtacgtgtagtgtctgaaatcaccgaatccaacggttct
tcttctatggcttccgtgtgcggcgcgtctctggcgctgatggacgcaggtgtgccaatc
aaagctgccgttgcgggtatcgcaatgggtctggtgaaagaaggcgacaactacgttgta
ctgtctgacattttgggcgacgaagatcacctgggcgatatggacttcaaagttgcaggt
tcccgcgacggtatctctgcactgcagatggatatcaaaattgaaggtatcaccaaagag
atcatgcaggttgcgctgaaccaggctaaaggtgcgcgtctgcatatcctgggcgtaatg
gaacaggcgatcaacgcgccgcgtggcgatatctctgagttcgcaccgcgtatccatacc
atcaagatcaacccggataagatcaaagacgttatcggtaaaggcggctctgttatccgt
gccctgaccgaagaaactggcactaccatcgaaatcgaagatgacggtactgtgaagatc
gcagcgaccgacggcgagaaagcgaaacatgctattcgtcgtatcgaagagatcactgca
gaaatcgaagtgggccgcgtctacactggtaaagtgacccgtatcgttgactttggcgca
tttgttgccatcggcggcggtaaagaaggtctggtccacatctctcaaatcgctgacaaa
cgcgttgagaaagtgaccgattacctgcagatgggtcaggaagtaccggtgaaagttcta
gaagttgatcgccagggccgtatccgtctgagcattaaagaagcgactgagcagtctcaa
cctgctgcagcaccggaagctccggctgctgaacagggcgagtaa

DBGET integrated database retrieval system