KEGG   Shigella sonnei Ss046: SSON_3568Help
Entry
SSON_3568         CDS       T00274                                 

Gene name
yhjA
Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ssn  Shigella sonnei Ss046
Brite
Enzymes [BR:ssn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SSON_3568 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
3736047..3737444
Genome map
AA seq 465 aa AA seqDB search
MKMVSRITAIGLAGVAICYLGLSGYVWYHDNKRSKQADVQASAVSENNKVLGFLREKGCD
YCHTPSAELPAYYYIPGAKQLMDYDIKLGYKSFNLEAVRAALLADKPVSQSDLNKIEWVM
QYETMPPTRYTALHWAGKVSDEERAEILAWIAKQRAEYYASNDTAPEHRNEPVQPIPQKL
PTDAQKVALGFALYHDPRLSADSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNVEQFWDGRAATLQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKAQFLGVYPQG
FSGENITDAIAEFEKTLITPDSPFDKWLRGDENALTAQQKKGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKKDFNFGEITAADIGRMNVTKEERDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKELPQEDVDDIVAFLHSLNGVYTPYMQDKQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggtctcacgtattaccgcgatcggcctggctggcgtcgcgatttgctattta
gggttatctggttatgtgtggtaccacgataataaacgcagtaaacaggccgatgttcag
gcatccgctgtcagtgaaaataataaggttttaggttttctccgcgaaaaaggatgcgac
tattgccacacgccttcggcagaattacccgcctattattatattcctggcgcgaaacag
ttgatggattacgacattaagcttggatataaatcttttaacctcgaggccgtgcgtgcg
gcactgctggctgataaacccgtttcgcaaagcgatctgaataagattgaatgggtgatg
cagtatgaaactatgccgccaacgcgttataccgcgcttcactgggcgggtaaggtgagt
gatgaagagcgggcggaaatactggcctggattgcaaaacagcgcgcggaatattacgcc
agcaatgatactgctccggagcatcgcaatgaaccggtgcagcccatcccgcaaaaactg
cctaccgatgcgcaaaaagtggcgttgggctttgcgctgtatcacgatccccgtttatcg
gctgatagcaccatttcatgcgctcattgccatgcgttgaatgcggggggcgtcgatggc
agaaaaacatcgattggtgttggtggcgcagttgggccgattaacgcgccgacggtattt
aactcagtatttaacgttgagcagttctgggatggtcgtgcggcaacattgcaggatcag
gctggtggaccgccgttgaacccgattgaaatggcgtcgaaatcttgggacgaaattatt
gctaagctggaaaaagatccgcagcttaaagcgcagttcctcggcgtctatccgcaaggt
ttcagtggcgaaaatattactgatgccattgctgaatttgagaaaacattaattacgccg
gattccccatttgataaatggttgcgtggagatgaaaatgcgctgacggcgcaacagaaa
aaaggctatcaattatttaaagataataaatgtgcaacttgtcatggtggtattattctc
ggtggacgttcctttgaaccgttggggctgaaaaaagactttaactttggggaaattacg
gcggcggatattggtcgtatgaatgttactaaagaagagcgtgataaattgcgtcagaaa
gtacccggtttacgtaacgttgctttaacggcaccgtacttccatcgcggtgacgtgccg
acgctggacggggcggtgaaactgatgctgcgctatcaggtaggcaaagagctgccgcag
gaggatgtggatgatatcgtagctttcctgcacagtctgaacggggtgtacacgccgtat
atgcaggataaacaataa

DBGET integrated database retrieval system