KEGG   Shigella sonnei Ss046: SSON_3860Help
Entry
SSON_3860         CDS       T00274                                 

Gene name
yhjM
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ssn  Shigella sonnei Ss046
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSON_3860 (yhjM)
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SSON_3860 (yhjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
4060793..4061899
Genome map
AA seq 368 aa AA seqDB search
MNVLRSGIVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIAPSDARKITTSEGQSYG
MFFALAANDRVAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDVW
MAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNP
SYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLIS
SYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPIGF
SAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDW
GQECANSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttgcgtagtggaatcgtgacgatgctgctgttggctgcctttagtgttcag
gcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaaggg
cgcgtcatcgcccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggt
atgttctttgccctggcggctaacgaccgtgtagctttcgataatattctcgactggacg
cagaacaatctcgctcagggctctttaaaagaacgtttgcccgcctggctgtggggcaag
aaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgatgtctgg
atggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatc
ggcagcgcgttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggt
tccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgttttaacccc
agctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggaccacg
ctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggtttttcgccagac
tgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagc
agctacgacgctatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaa
aaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttat
ccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccgatcggtttt
tctgccgccatgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgccagcgc
gtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctgtttgga
caaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactgg
ggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system