KEGG   Shigella sonnei Ss046: SSON_4088Help
Entry
SSON_4088         CDS       T00274                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00010  Glycolysis / Gluconeogenesis
ssn00051  Fructose and mannose metabolism
ssn00562  Inositol phosphate metabolism
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01120  Microbial metabolism in diverse environments
ssn01130  Biosynthesis of antibiotics
ssn01200  Carbon metabolism
ssn01230  Biosynthesis of amino acids
Module
ssn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssn_M00002  Glycolysis, core module involving three-carbon compounds
ssn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSON_4088 (tpiA)
   00051 Fructose and mannose metabolism
    SSON_4088 (tpiA)
   00562 Inositol phosphate metabolism
    SSON_4088 (tpiA)
Enzymes [BR:ssn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSON_4088 (tpiA)
Exosome [BR:ssn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSON_4088 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSON_4088 (tpiA)
  Exosomal proteins of melanoma cells
   SSON_4088 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAZ90603
ShiBASE_China: SSO4088
UniProt: Q3YV59
Position
complement(4324781..4325548)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacttctgcc
gctatgctgaaagacatcggcgctcagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagatatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system