KEGG   Shigella sonnei Ss046: SSON_PA03Help
Entry
SSON_PA03         CDS       T00274                                 

Gene name
sulII
Definition
(GenBank) SulII
  KO
K18824  dihydropteroate synthase type 2 [EC:2.5.1.15]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00790  Folate biosynthesis
ssn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSON_PA03 (sulII)
Enzymes [BR:ssn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SSON_PA03 (sulII)
Antimicrobial resistance genes [BR:ssn01504]
 Gene variants
  Sulfonamide resistance genes
   Dihydropteroate synthase
    SSON_PA03 (sulII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABO87505
UniProt: A4SH34
Position
pSS046_spA:5780..6595
Genome map
AA seq 271 aa AA seqDB search
MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVS
SDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAK
SSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFF
LGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAA
GGADFIRTHEPRPLRDGLAVLAALKETARIR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcgctcatcattttcggcatcgtcaacataacctcggacagtttctccgat
ggaggccggtatctggcgccagacgcagccattgcgcaggcgcgtaagctgatggccgag
ggggcagatgtgatcgacctcggtccggcatccagcaatcccgacgccgcgcctgtttcg
tccgacacagaaatcgcgcgtatcgcgccggtgctggacgcgctcaaggcagatggcatt
cccgtctcgctcgacagttatcaacccgcgacgcaagcctatgccttgtcgcgtggtgtg
gcctatctcaatgatattcgcggttttccagacgctgcgttctatccgcaattggcgaaa
tcatctgccaaactcgtcgttatgcattcggtgcaagacgggcaggcagatcggcgcgag
gcacccgctggcgacatcatggatcacattgcggcgttctttgacgcgcgcatcgcggcg
ctgacgggtgccggtatcaaacgcaaccgccttgtccttgatcccggcatggggtttttt
ctgggggctgctcccgaaacctcgctctcggtgctggcgcggttcgatgaattgcggctg
cgcttcgatttgccggtgcttctgtctgtttcgcgcaaatcctttctgcgcgcgctcaca
ggccgtggtccgggggatgtcggggccgcgacactcgctgcagagcttgccgccgccgca
ggtggagctgacttcatccgcacacacgagccgcgccccttgcgcgacgggctggcggta
ttggcggcgctgaaagaaaccgcaagaattcgttaa

DBGET integrated database retrieval system