KEGG   Sulfolobus solfataricus P2: SSO0008Help
Entry
SSO0008           CDS       T00054                                 

Definition
IS605-TnpB family transposase
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4500..5348
Genome map
AA seq 282 aa AA seqDB search
MKESLIEAKVMDYGKLKDIQKEILYYKLYVDALKKKGIKEKVDPPPTLPKSIVSSVLTGG
IPRDGPLQIELVSNDVVKIKEYNTLVKIQSDSRLPLYAIVEYRDTDIRVYLAYRENPSIV
GLDLGLRHLITIVAIKDTKPWKVRFFDEPKLMEKFANFLSENQGIIKLEEMKSNAKRIIY
EAVSFIEDLEPKVVAMENLEYFETKTGKGLRALQNMLENEIRRRGIRYRKIDPYNTSRVC
AKCGYKKGEILGSLFVCPACGYKADRDYNAAYNIALKCYYTC
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagagtctcatagaagcaaaagttatggattatggtaaactaaaggacattcaa
aaggaaattttatattacaagctctatgttgacgcattgaaaaagaaagggattaaggaa
aaagtggacccaccccctaccttgcccaaatctattgtatcttcagtgctcactggagga
atccctagagatggcccactacagatagaattagttagtaatgatgtagtaaagataaag
gagtataacactttagtaaaaatacagagtgattctaggctaccgttatatgccatagta
gagtacagggatactgatataagggtttatttagcttatcgagagaatcctagcatagtt
ggattagacctaggcttacggcatctaataacaattgttgcaataaaagataccaaacca
tggaaagtgagattctttgatgagcctaaacttatggagaaatttgcaaatttcttaagt
gaaaatcaaggaattattaagttagaagaaatgaagagtaacgctaaaagaattatttac
gaagctgtaagctttattgaagatttagaaccaaaagtagttgcgatggagaatttggaa
tattttgagaccaaaacgggtaaaggattaagagctttacagaatatgctagagaacgaa
atacgaagaagaggtattagatatagaaaaatagacccatataacacatcaagggtatgt
gcaaagtgtggatacaagaaaggtgaaatattaggctcgctatttgtatgtccagcatgt
ggatataaagcggatagagattataacgcagcatataatatagcactaaaatgttattac
acttgctaa

DBGET integrated database retrieval system