KEGG   Sulfolobus solfataricus P2: SSO0017Help
Entry
SSO0017           CDS       T00054                                 

Definition
ATP-dependent helicase
Orthology
K06877  
DEAD/DEAH box helicase domain-containing protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15589..17808
Genome map
AA seq 739 aa AA seqDB search
MEILSEVNDKLKTFNAKIAHVHTETFLEPEYGPSINEIDIDDKLKKSIIEYGIERLYKYQ
YDAYRKIKNKENVMIISGTGTGKTEAFLIPILDLALKGERSVLVYPTKALARDQLTRVYK
LARELGLNVGIFDGDTPEKERERLYRNPPHILITNPDMIHLGLALSTRFRFLLRTADHFI
FDEVHVYEGVLGAHIRNLADRIKEFKNDIHIVASSATVGATKYLFEELFGVEGEIIEGIR
RRKGIAIHSIIDSGNSSRWTLAAYLAAVLVKNGLKVLVFTDSQQMAELVAKIADRFRVNL
EVHRAGLIAEERIKVEEKLRNGELDGVVATPTLELGIDIGTIDAVIMAENPPSYTKYVQR
AGRAGRRNNAGLVFTILGDDPIDSYYLRHPEEFFTRKIQALTFDPTNIEVIKIHALAYLA
EKYRVKLNNLPPLWKKAYEILATESRAKIVGSYVLATPETKKYVATTSLRSVGPIVRIYE
DKKKIGERELPAALHDLYPNAVYLISKKTYIIEEFDIDRLIAKVRKVNSELSYYTKPLYS
MDLLEFNKKDEREVYGEKVEYGDMKLVMRVEGYVTYDVYSKRGKNEYFYENPISFTYNTK
GLLIYHPLIDDFTLIDHMETYHATEHVLISAARVAAGASLTDLGGISYPSGHVVIYDSSI
GGSGVSKLLFERLEQAYEVALDIVKSCNCEDGCPNCVYSPYCGNNNKYLSRKKSLRLIDG
LIKGTIKGVNKDREGNPIA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtggagattctaagtgaagtaaatgacaagctaaaaacgtttaacgctaagatagctcac
gttcatacagaaacttttctggaaccggaatatggaccatccataaacgaaatagatatt
gatgataagctaaagaaatctattatagaatatggaatagagagattatataaatatcaa
tatgatgcataccgaaaaataaaaaataaggaaaacgtcatgatcatatcaggtactgga
accggtaaaactgaagcatttttaatcccaattctagacctagcattaaagggcgaaaga
agtgttttagtttatcctacaaaagctctagcaagggatcaacttactagagtttacaaa
ttagcaagagaattaggattgaatgttgggattttcgatggagatacaccggaaaaagag
agagaaagattgtatagaaatcctcctcacatactaataactaatccagatatgatacat
ttaggcctagctttaagtactagattcaggtttttgttaagaactgctgatcattttata
tttgatgaagttcatgtatatgaaggcgttttaggtgctcatataagaaatctagctgat
agaatcaaggaatttaagaacgatattcatatagtagcgtcaagtgccacagtaggcgct
acaaaatacttgtttgaggagctgttcggggttgagggggaaataatagaggggataaga
agaagaaaaggaatcgcaatacatagcattattgatagtggtaattctagtaggtggacg
ttggctgcttatttggcggcagttctagttaaaaatgggctaaaagtactagtgtttact
gattctcaacagatggcagagttagtagctaagatagctgatagatttagagtaaatcta
gaggtgcatagagcaggtttaattgcagaagaaaggataaaagtagaggagaagctaaga
aatggagaattggatggagtagtggccacacctactttagagctaggaatagacatagga
accattgatgcagtaataatggcagagaatccaccaagttatactaaatacgttcagaga
gctgggagagcagggagaaggaataacgctggtttagtatttacaatcttaggagatgat
cctatagatagttactatcttaggcacccagaggagttctttaccagaaaaatacaagca
ttaacatttgatcctacaaacatagaagtaattaaaattcatgctttagcatatttggct
gaaaaatatagagtaaagttgaataatttacctcctctttggaaaaaagcatatgagata
ttagctaccgaaagcagagctaaaattgtaggtagttatgtcttagctactccagaaact
aaaaaatatgttgccacaacctctcttaggagtgtaggccccatagtaagaatatatgaa
gataagaagaaaatcggcgaaagagaactgcctgcggcattgcatgacctatatccaaat
gcagtatatttgatttcaaagaagacttacattatagaggaatttgatattgacagatta
atagcaaaggtaagaaaagttaatagtgagttatcgtattacactaaacccctttattca
atggatctattggagtttaataaaaaagatgagagagaagtatacggagaaaaagtggaa
tatggggacatgaaattagtcatgagagtggaaggttatgtaacttatgatgtatattct
aaaagggggaaaaatgagtacttttatgaaaaccctatttcatttacatataatacgaag
gggcttctaatataccacccattaatagatgacttcactctcatagatcatatggagacc
taccatgcaaccgagcacgtattaatatctgcagccagagttgccgcaggagcgtcgtta
actgacttgggaggaataagctatcctagtggacacgttgtaatatacgactcctccata
ggaggaagcggagtttctaaattattatttgaaagattggagcaagcttacgaagttgca
ttagatatagttaagagttgcaattgtgaggatggttgtcctaattgtgtatacagtcca
tattgtggtaataataataaatatttatctaggaaaaaatcgttaagattaatagacggg
ttaataaagggtacaataaaaggagtaaacaaggatagagagggaaacccaattgcataa

DBGET integrated database retrieval system